DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-184

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001023926.1 Gene:nhr-184 / 185730 WormBaseID:WBGene00018415 Length:407 Species:Caenorhabditis elegans


Alignment Length:409 Identity:84/409 - (20%)
Similarity:161/409 - (39%) Gaps:94/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRRSVR--KNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFK 232
            |.||...|.|.|:|..||..|..||||:.|  :.....|.:. :|.:......:|:.|||:||:|
 Worm    11 CKICDLPAHGNHFGVLSCRACAAFFRRASRSPRFQDKACEYG-DCRIFDAGAYRCKICRLKKCYK 74

  Fly   233 AGMKKEAVQNERDRIS-----CRRTS------------------NDDPDPGNG----LSVISLV- 269
            .||.....|.:||.||     .:||.                  :.:|:..:.    :.|..|| 
 Worm    75 VGMDASKFQKDRDLISSSNAYLKRTKVYAPQSLANFLGRPEFIISFEPEKASPFKTVIDVTDLVH 139

  Fly   270 KAENESRQSKAGAAMEPNIN----------EDL----SNKQFASINDV--CESM---KQQLLTLV 315
            ||....::..|.:.|....:          |||    ||.:...:.::  .||:   :|..|...
 Worm   140 KAAEIFQEDLANSPMPYKYSNSLEKLTLEMEDLRLRSSNHKVKIVRNIGKAESLVFFEQMFLATA 204

  Fly   316 EWAKQIPAFNELQLDDQVALLRA---------------------HAGEHLLLGLSRRSMHLKDVL 359
            .|..::|.|..|.|..::.:|::                     ..|.::.:......::::|:.
 Worm   205 NWYARLPDFTSLDLRVKLEILKSTWMLWIRLNKLAETAQNQRIKEMGANIFMCSENTCLNVQDIN 269

  Fly   360 LLSNNCVITRHCPDPL---VSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAK 421
            :..:.|  |.:..:.:   :.||:|  :...:.:::||.      ::.|:......|:....|..
 Worm   270 VDWSWC--TNYGAEQMQAFLMPNID--KHWRQPVEDLVK------LNPTDMELNFMLIQLCLNDA 324

  Fly   422 GLNEPHRIKSLRHQIL----NNLEDYISDR----QYESRGRFGEILLILPVLQSITWQMIEQIQF 478
            |.....|:.....::|    :||.:|.:.:    .|.  ||..:::.|..:::....:..|:.:.
 Worm   325 GKKFQGRVLEATDKLLQINADNLHNYYTKKLNMPSYS--GRLTKLMKINQIVEEDVRERKEKAKI 387

  Fly   479 AKIFGVAHIDSLLQEMLLG 497
            .::|.:..|.....||..|
 Worm   388 VEVFDLFSIVYSHPEMFEG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 27/76 (36%)
NR_LBD_HNF4_like 264..494 CDD:132729 47/281 (17%)
nhr-184NP_001023926.1 ZnF_C4 10..80 CDD:197701 26/69 (38%)
Hormone_recep 177..384 CDD:278530 34/218 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.