DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-180

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_503286.1 Gene:nhr-180 / 185170 WormBaseID:WBGene00017961 Length:399 Species:Caenorhabditis elegans


Alignment Length:373 Identity:82/373 - (21%)
Similarity:130/373 - (34%) Gaps:123/373 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SPTVCAICG-DRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFAR-NC---VVDKDKRNQCRYC 225
            |...|.||. ::..|.|:|..||..|..||||:|..      |::| .|   ..|: |:..|:.|
 Worm    12 SHKTCQICKVEKCHGNHFGVDSCRACAAFFRRTVHS------RWSREKCQGGTCDR-KKLLCKPC 69

  Fly   226 RLRKCFKAGMKKEAVQNERDRI-----------SCRRTSN-------DDPDP-----------GN 261
            ||::||:.||..:..|..||.|           |..|...       .|.:|           |.
 Worm    70 RLQQCFEGGMVTDKFQYNRDLINPVYLKSSIPSSLERLLGKPHFVLISDKNPKKTTIDVHRLLGE 134

  Fly   262 GLSVISLVKAE----NESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEW----- 317
            ...:::|..|.    ..:|..|...|:..|:.       |..::.:..:.|.::||..|:     
 Worm   135 ATKILNLGHAIPTYCGNNRLKKLSLAVHNNVT-------FEKLDVIKRATKSEILTNWEYYFKRV 192

  Fly   318 ---AKQIPAFNELQLDDQVALLRA--HAGEHLLLGLSRRSMHLKDVLLLSNNCVITRHCPDPLVS 377
               ......|.:|::..|:.||:.  |.... |..::..:.:.|.|                   
 Worm   193 ATCLNHFDEFKKLEIPMQLKLLQTIWHVWGR-LEKITSSARYQKTV------------------- 237

  Fly   378 PNLDISRI---GARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQI--- 436
            .|..:|.:   ...|:|     :|||.||...|:..       ||       .::|:...|.   
 Worm   238 ENSKLSEVVFQSGWIVD-----VKDVDIDCNWFSNF-------PN-------EQVKNFMLQTSTD 283

  Fly   437 LNNLEDYISDR----------------QYESRGRFGEILLILPVLQSI 468
            |.|:..||.|.                ||......|||..:....|::
 Worm   284 LFNVIQYIHDLDPTDVELTYMLAQLCFQYAGNRHRGEIQEVCEQFQNV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 28/79 (35%)
NR_LBD_HNF4_like 264..494 CDD:132729 45/241 (19%)
nhr-180NP_503286.1 ZnF_C4 15..82 CDD:197701 27/73 (37%)
Hormone_recep 167..373 CDD:278530 39/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.