DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-89

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_493155.1 Gene:nhr-89 / 184026 WormBaseID:WBGene00003679 Length:310 Species:Caenorhabditis elegans


Alignment Length:344 Identity:79/344 - (22%)
Similarity:137/344 - (39%) Gaps:76/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGD-RATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKA 233
            |.:|.. :.|.:|:|.::|..|..|||||:  |.::.|....:|.:..|::..||.||..||.::
 Worm     8 CRVCHSVKGTRRHFGITACMSCSSFFRRSL--NCKFYCPANNSCTILDDQKQFCRSCRYNKCVQS 70

  Fly   234 GMKKEAVQNERDRISCRRTSNDDP--DPGNGLS------VISLVKAENES----RQSKAGAAMEP 286
            ||:::.|:.:..|....|.....|  ...|.||      :...||..|||    |||....|.:.
 Worm    71 GMRRDCVRKQSYRRQAGRKEAKSPAVSCSNKLSESYEELLNFYVKEANESIARKRQSPLKNAHQV 135

  Fly   287 NINEDL----SNKQFASINDVCESM------KQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAG 341
            ..:::|    .::...|::.|....      .:.:.||:.:.|    |....:|......::.:.
 Worm   136 KTSKELLEISKSEDKTSLDAVLHCYGTYILDDEDITTLIRYFK----FMNTWIDSAFVYSKSTSN 196

  Fly   342 EHLLLGLSRRSMHLKDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTE 406
            |.||.|                                .||.:...:|...:...:|::.::..|
 Worm   197 EELLDG--------------------------------NDICKFAYQIDTSIGLSLKNLNLNIFE 229

  Fly   407 FA-----CIKALVFFD--PNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPV 464
            :|     ||..|.|::  |..|.|...| .|.:...:....|:|:||  .:...|.|||.:.:..
 Worm   230 YAALRAICIWNLKFYETSPKMKSLALEH-YKGITGALRQYYENYMSD--MDIAVRIGEITMQITT 291

  Fly   465 LQSITWQMIE-----QIQF 478
            :..:...:|.     ||.|
 Worm   292 ISDLFHDLITLHQKYQIPF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 25/75 (33%)
NR_LBD_HNF4_like 264..494 CDD:132729 49/247 (20%)
nhr-89NP_493155.1 ZnF_C4 7..75 CDD:197701 24/68 (35%)
metallo-dependent_hydrolases <121..>160 CDD:294200 7/38 (18%)
HOLI 150..292 CDD:214658 34/180 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.