DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-174

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_493149.2 Gene:nhr-174 / 184021 WormBaseID:WBGene00008474 Length:319 Species:Caenorhabditis elegans


Alignment Length:366 Identity:77/366 - (21%)
Similarity:115/366 - (31%) Gaps:137/366 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VCAICGDRATGK-HYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFK 232
            ||.:|...:..: |:|...|..|..||||:|..|.:|.|.....|   |.||..||.||...|.|
 Worm     9 VCPVCEFPSNVELHFGGLVCGACAAFFRRTVSLNIRYLCEKKNQC---KGKRKNCRACRFDYCVK 70

  Fly   233 -AGMKKEAVQNERDRISCRRTSNDDP--------DPGN-----GLSVISLVKAENESRQSKAGAA 283
             ||||:..|:.       |:.|.:.|        |.||     |....:..|....||:|    :
 Worm    71 IAGMKRNLVRQ-------RKNSTNTPMYILNRRKDSGNEEVVRGFVTSTQSKWAQHSRKS----S 124

  Fly   284 MEPN--INEDLS--------------------------------------------NKQFASIND 302
            |.||  ..:|:|                                            ||..|.|..
 Worm   125 MSPNKEAEKDVSKILKISHGRLLKYYIYQITQGKWVNMNTLNIKSVEEFLEITSIHNKLAAEICK 189

  Fly   303 VCESM----KQQLLTL----------VE--WAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRR 351
            .|..:    .:.:||:          :|  |...:.|...:|:||          ..|.|.|.:.
 Worm   190 TCPGVDLLDNEDILTIRKYFQFSNVWIESAWNYLMSADKHVQIDD----------SELDLTLLKF 244

  Fly   352 SMHLKDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFF 416
            ...:|..||:|                                  :..:..:..|||..|::..:
 Worm   245 INQVKSTLLVS----------------------------------LSQLKFNTIEFAAFKSICIW 275

  Fly   417 DPNAKGLNEPHRIKSLRHQ--ILNNLEDYISDRQYESRGRF 455
            .....|.:...:|.:..|.  :...|.||........:.|:
 Worm   276 KLVYHGTSRAMKIIAQEHYEGVAKALNDYYQTYTSMKKSRY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 29/76 (38%)
NR_LBD_HNF4_like 264..494 CDD:132729 40/256 (16%)
nhr-174NP_493149.2 ZnF_C4 10..77 CDD:197701 28/69 (41%)
HOLI 177..314 CDD:214658 30/180 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.