DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-167

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_510004.1 Gene:nhr-167 / 183613 WormBaseID:WBGene00008208 Length:343 Species:Caenorhabditis elegans


Alignment Length:326 Identity:82/326 - (25%)
Similarity:136/326 - (41%) Gaps:57/326 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRR-SVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKA 233
            ||:||...|..:|...||:.||.|||| .||......|.....|........:|..||.:||...
 Worm     8 CAVCGRFTTEFNYSVLSCNSCKIFFRRLIVRTVPIKKCFRGERCFEKTPYIFKCTSCRFQKCLYV 72

  Fly   234 GMKKEAV-----QNERDR----ISC-RRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNI 288
            ||...:.     ||:..|    |.| |.|.|...|     |:.:....|           |.||:
 Worm    73 GMTLPSYLLVLEQNKEQRLAITIDCVRNTHNKRMD-----SLFNFFVTE-----------MNPNV 121

  Fly   289 NEDLSNKQFASINDVCESMKQQ-------------LLTLVEWAKQIPAFNELQLDDQVALLR-AH 339
            ::      ...:|.:..:.:.:             .:|.:::.||.|..|.|:..||:.||: ::
 Worm   122 DD------IVELNKITYTKRDEHIRMDFQTWAFHSCVTTIDFMKQFPFVNLLRSTDQMILLKESY 180

  Fly   340 AGEHLLLGLSRRSMHLKDVLLL--SNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGI 402
            .....|:..:|.....|..:..  ..:|:.......|.:||||: :||..|:||:|    :::.|
 Worm   181 VKLGALISATRAYSSKKQCISFPDGTDCLPKTQWTVPKISPNLE-NRIRCRVIDKL----RELNI 240

  Fly   403 DDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQ-ILNNLEDYISDRQYESRG--RFGEILLILPV 464
            .:.||..:..|:|.:|....|:|..::....:| :.::...|.....|:..|  ||.|:|.:..:
 Worm   241 QNDEFYLLSVLLFCNPAITNLSENGQLLLTSYQKMYSSALLYYCLLTYQKSGPSRFSELLGLFTL 305

  Fly   465 L 465
            |
 Worm   306 L 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 27/80 (34%)
NR_LBD_HNF4_like 264..494 CDD:132729 48/221 (22%)
nhr-167NP_510004.1 ZnF_C4 7..75 CDD:197701 24/66 (36%)
HOLI 147..306 CDD:214658 41/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.