DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-163

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_504766.1 Gene:nhr-163 / 183182 WormBaseID:WBGene00016368 Length:358 Species:Caenorhabditis elegans


Alignment Length:392 Identity:90/392 - (22%)
Similarity:138/392 - (35%) Gaps:120/392 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKD--KRNQCRYCRLRKCF 231
            :|.:||...:..|||.|.|..|..||||.|....|..     :|..|:.  ..:.|||||:.||.
 Worm    13 LCLVCGADGSEPHYGGSCCRACAAFFRRYVHSTKQEI-----SCTCDQRLISSHPCRYCRMLKCM 72

  Fly   232 KAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQ 296
            |.||.|..||..|::.....|.     ||..:.:            ||            |||  
 Worm    73 KIGMCKTQVQPPREKNKILNTF-----PGTTIMI------------SK------------LSN-- 106

  Fly   297 FASINDVCESMKQQLLTLVEWAKQIPAFNELQLDD-------QVAL-------LRAHAGEHLLLG 347
             :.|...|.:|.:   .:.:|........||:.||       |:..       |....||.:...
 Worm   107 -SIIPKSCNNMYR---AVAKWVDFDQRRKELRGDDYFDYNLTQITKMVNFNTNLLWKLGESIFSD 167

  Fly   348 LSRRSMHLKDVLLLSNNCVITRHCPDPLVSPNLDIS---------------------------RI 385
            :||.|...|:.::  :|..|....   |:.|.:|.|                           :.
 Worm   168 VSRLSKEDKNSMI--SNFYIKWQL---LMEPAIDYSAQYEQFKNYIGSNAYYQKCAYFYGSSMQK 227

  Fly   386 GARIID-ELVTVMK---------------DVGIDDTEFACIKALVFFDPNAKGLNEP--HRIKSL 432
            |.:|.| |.|.|..               .:..|..|:..|..|:.||.....:::.  :...::
 Worm   228 GNKISDVETVKVFSPFWDYYYADFAEPVYKMNYDKVEYMAIFLLLLFDGAYSDISDDGVNLCTNI 292

  Fly   433 RHQILNNLEDYISDRQYESRGRFGEILLILPVL----QSITWQ--------MIEQIQFAKIF-GV 484
            |..||..|..|.|:... |..|..:|:..|.:|    :.:.:|        ||....:.:|: |:
 Worm   293 RKVILRELNSYQSNNNC-SEVRLADIMETLRLLDKHEEKLHYQFWMCGSHKMIMDENYVQIYLGI 356

  Fly   485 AH 486
            .|
 Worm   357 KH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 30/76 (39%)
NR_LBD_HNF4_like 264..494 CDD:132729 56/295 (19%)
nhr-163NP_504766.1 ZnF_C4 13..76 CDD:197701 25/67 (37%)
HOLI 165..327 CDD:214658 33/167 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.