DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-139

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_504767.1 Gene:nhr-139 / 183179 WormBaseID:WBGene00016365 Length:346 Species:Caenorhabditis elegans


Alignment Length:345 Identity:70/345 - (20%)
Similarity:125/345 - (36%) Gaps:64/345 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAG 234
            |.:||......|:|..||..|..||||.|   |.........|:......:.||:||:.||...|
 Worm     3 CKVCGANGAEAHFGGESCRACAAFFRRYV---HSQKLVIECTCLHRLPSSHPCRHCRMEKCIATG 64

  Fly   235 MKKEAVQNERDR-------------ISCRRTSNDDPDPGNGL-SVISLVKAENESRQSKAGAAME 285
            |....||..|::             ||...||.......|.| :|.:.|..:...:|.:.....:
 Worm    65 MTMCKVQGNREKNKVRGYYPGYLPVISTLPTSVIPKSCDNILRTVANWVDLDQTRKQLRGENFFD 129

  Fly   286 PNINE-----DLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVA------LLRAH 339
            .|:.:     .:.:|....:.:|..|             .:..||....|..:|      ::...
 Worm   130 HNLTQVTKLSKMDSKLLWDLGEVIFS-------------DVSKFNSFDKDSMIANFFPKWIIMEC 181

  Fly   340 AGEHLLLGLSRRSMHLKDVLLLSNNCVITRHC--------PDPLVSPNLDISRIGARIID----E 392
            |.::        |::.:.......:....:.|        |:.....:.|..:|.::..|    |
 Worm   182 AIDY--------SLNQEQFQSFIGSIEYYKKCAHFYGSSMPEEKRLDDEDTIKIFSKFWDWHYSE 238

  Fly   393 LVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEP--HRIKSLRHQILNNLEDYISDRQYESRGRF 455
            :...:.....|..|:..|..|:.||.....:::.  ...:::|..||..|:.|.||:.. ||.|.
 Worm   239 IAHPIFLKKFDKIEYMAIFLLLLFDSAYMNISDDGVKLCQNIRKVILRELQGYQSDKNC-SRYRL 302

  Fly   456 GEILLILPVLQSITWQMIEQ 475
            .|.:..:.:|:....::.|:
 Worm   303 AETVDTVRLLEKAEGKLQEE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 25/74 (34%)
NR_LBD_HNF4_like 264..494 CDD:132729 38/237 (16%)
nhr-139NP_504767.1 ZnF_C4 3..66 CDD:197701 22/65 (34%)
HOLI 154..315 CDD:214658 31/182 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.