DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-136

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_506039.2 Gene:nhr-136 / 182566 WormBaseID:WBGene00003726 Length:435 Species:Caenorhabditis elegans


Alignment Length:403 Identity:92/403 - (22%)
Similarity:156/403 - (38%) Gaps:101/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNNNLSGSGSGTNSSQQQLQQQQQQQSPTVCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQY 204
            ||.:.:...|..:|.:.|.....:...|:.|.:|...|||.||...||:|||.|||||:....:|
 Worm    23 PNMDENLEDSKPSSLKYQKAMMSRGTCPSNCKVCRHSATGYHYDVPSCNGCKTFFRRSILDGRKY 87

  Fly   205 TCRFARNCV-----VDKDKRNQCRYCRLRKCFKAGMKKEAVQNE---------RDRISCRRTSND 255
            ||...|.|:     ||..:| .||.||..||.:|||...|:|.:         |..|..::.:..
 Worm    88 TCLKMRKCLSGTEPVDLSRR-MCRACRFEKCVEAGMNPSAIQADMKTTDGELLRKEIMIKQKTAV 151

  Fly   256 DPDPGNGLSVISLVKAENESRQSKAG--AAME-----------PNINEDLSN------------- 294
            |     .|:...::.:..:..|...|  ..||           |..|.|:..             
 Worm   152 D-----FLNTPQVIMSFEDKVQGIIGKLTVMELKIEPLYTGGLPPGNRDIRKLDELIDAPLILSY 211

  Fly   295 ------KQFASINDVCESMKQQ--------LLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLL 345
                  |...|::::...:|..        .|..:|::|.....:::.:..:..|:: ||     
 Worm   212 DEIPNLKYCPSVDELTGEIKPSGACYIHCGYLASIEYSKMFDFAHKIDVASKATLIK-HA----- 270

  Fly   346 LGLSRRSMHLKDVLLLSNNCVITRHCPDPLVSPNLDIS-----RIG-------ARIIDELVTVMK 398
                  ::...|::....:  ..:...|.|:.||...:     |.|       |.:...|.||::
 Worm   271 ------TIMCADIMTAFFS--YYQRKSDRLIHPNGMFAGPPKYRYGEAGTKYQASMQRTLATVLR 327

  Fly   399 DVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISD------RQYES---RGR 454
            . .::..|:..:||:|..:|....|:     .|::..|....|:|:..      ..|.|   ..|
 Worm   328 H-ELNRIEYMLLKAIVLCNPAVSSLS-----ISVQQIIGKEREEYVRTLLTYCLLNYGSVHGPSR 386

  Fly   455 FGEILLILPVLQS 467
            |..:|.|:.||:|
 Worm   387 FSALLAIMSVLES 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 36/88 (41%)
NR_LBD_HNF4_like 264..494 CDD:132729 46/265 (17%)
nhr-136NP_506039.2 NR_DBD_HNF4A 53..128 CDD:143518 35/75 (47%)
HOLI 243..400 CDD:214658 36/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.