DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-44

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_505313.1 Gene:nhr-44 / 179276 WormBaseID:WBGene00003634 Length:428 Species:Caenorhabditis elegans


Alignment Length:274 Identity:66/274 - (24%)
Similarity:104/274 - (37%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 NSMFSPNNNLSGSGSGTNSSQQQLQQQQQQQSPTVCAICGDRATGKHYGASSCDGCKGFFRR-SV 198
            :|:.||:.:.|.|.:....|::             |.:|...:.|.|:|..||..|..|||| .|
 Worm     2 DSISSPSTSSSASSTPKLISEK-------------CLVCFQPSHGNHFGVDSCRACAAFFRRVFV 53

  Fly   199 RKNHQYTCRFARN-CVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNG 262
            ....|:.||...| |..|:..|..|:.||..|||..|||.:.:|.:|||........||......
 Worm    54 THKQQFPCREGDNKCTPDEWGRWSCKRCRSDKCFALGMKPDNIQRDRDRFIFSDNFRDDRKRKTS 118

  Fly   263 LSVISL-----VKAENESRQSKAGAA----------MEPNINE-----------DLSNKQFASIN 301
            .|::.|     |..:..:..:..|:.          :.|.|.:           :.|.|..:|:.
 Worm   119 ESIVPLSVERFVGKQLVTTYTSTGSGKNIEYITFFDLTPIIKDADYILKRIPKLEKSVKVKSSLE 183

  Fly   302 DVC----ESMKQQLLTLV-----------------------EWAKQIPAFNELQLDDQVALLRAH 339
            .:.    |..|:||...|                       ||......|.:|:.::::.:|:..
 Worm   184 QLAFGLQEVRKEQLFESVPELRKIGKMETWDNWVKGMRRAGEWIMHFEEFRQLEQEEKMVILKCM 248

  Fly   340 AGEHLLLGLSRRSM 353
              .||.:.|.|.||
 Worm   249 --WHLFIRLERISM 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 30/76 (39%)
NR_LBD_HNF4_like 264..494 CDD:132729 25/143 (17%)
nhr-44NP_505313.1 ZnF_C4 23..94 CDD:197701 29/83 (35%)
Hormone_recep 198..403 CDD:278530 12/65 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.