DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnf4 and nhr-20

DIOPT Version :9

Sequence 1:NP_723413.1 Gene:Hnf4 / 44544 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_497849.1 Gene:nhr-20 / 175546 WormBaseID:WBGene00003619 Length:457 Species:Caenorhabditis elegans


Alignment Length:445 Identity:96/445 - (21%)
Similarity:173/445 - (38%) Gaps:127/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 CAICGDRATGK-HYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKA 233
            |.:|.....|. |:|::||..|..||||:|..|.|:.|:..:|||:..:.|..||.||..||.||
 Worm    19 CLVCEHPDGGSAHFGSTSCLACAAFFRRTVSLNIQFQCKKDKNCVIFHELRMICRACRFDKCVKA 83

  Fly   234 GMKKEAVQNER---------------DRI-----SCR-RTSNDDPDPGNGLSV------------ 265
            ||::|.||..|               |:|     .|: ..|.|..|..:.||:            
 Worm    84 GMRRECVQKRRSNKKIPKKHMNMLREDQIKMEYDECKFECSGDQTDDNSPLSIEKKSPPGLLPND 148

  Fly   266 ---ISLVKAENESRQSKAGAA---MEPNINEDLSNKQFASIN----------------------- 301
               ::..|.:.....|.:|.:   :|.:.:..|:..:..|:|                       
 Worm   149 SPMMADFKFDPSDIPSTSGGSTQRLERSPSPKLAESKILSMNGEELLRFYVDQLKNSMDRRRMIF 213

  Fly   302 -----------------DVCE----SMKQQL-------LTLVEWAKQIPAFNELQLDDQVALLRA 338
                             |..|    |:|:|.       |...::.|..|.|:.|...::....|:
 Worm   214 TDTALLAVIDDRGDVPFDATEPPPHSLKRQYESQRFDNLLAFDFCKCCPGFDFLSRVEKAIFFRS 278

  Fly   339 HAGEHLLLGLSRRSMH------LKDVLLLSNNCVITRH------------CPDPLVSPNLDISRI 385
            .:..:.||.::..::.      .:.||:.::..|.|.:            |...  ...|.:..:
 Worm   279 CSLAYCLLDIAWITVQAYPEEAAEPVLMYTDGSVCTVNNLSYGWDDEEDICAHD--KKKLFLGFL 341

  Fly   386 GARIIDELVTVMKDVGIDDTEFACIKALVF-------FDPNAKGLNEPHRIKSLRHQILNNLEDY 443
            | |..|.:...::::.:...|||.:|||..       |.|:.|.:.:.|     ...:||.|.:|
 Worm   342 G-RFNDAICRPIRNLKMTHVEFAALKALCIWKLGYCEFTPSMKVIGKEH-----EEALLNGLHNY 400

  Fly   444 ISD---RQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEML 495
            ..|   ...|:..|.|.::|::..:..:...::|..:.|::|.:..:|:|.:.:|
 Worm   401 YDDLYGNPDETGMRIGNLILLMGTVFEMNQLIMETYKSAELFELFKLDALSKSLL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 34/90 (38%)
NR_LBD_HNF4_like 264..494 CDD:132729 54/326 (17%)
nhr-20NP_497849.1 ZnF_C4 18..88 CDD:197701 30/68 (44%)
NR_LBD 244..428 CDD:132726 36/191 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.