DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enc and AT5G05100

DIOPT Version :9

Sequence 1:NP_001261376.1 Gene:enc / 44543 FlyBaseID:FBgn0004875 Length:1942 Species:Drosophila melanogaster
Sequence 2:NP_568149.1 Gene:AT5G05100 / 830392 AraportID:AT5G05100 Length:324 Species:Arabidopsis thaliana


Alignment Length:331 Identity:66/331 - (19%)
Similarity:115/331 - (34%) Gaps:122/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 KNPKDRNILLKIEKDLIDFVQENSRGCEYRFPP-ASSYNRMLIHRTAAFFGM------EHNVDTE 501
            :||:.|..:|::|.|:..|.|...:. :|.|.| .:||.|::.||.|..:|:      ...||..
plant    20 QNPRHRLTILRMELDIQKFFQSPEQQ-QYEFQPLPTSYLRLIAHRVAQHYGLFTTALEGGGVDGS 83

  Fly   502 TQQCVIVAVAKNTRIPEIRFQSLVRDDARKSILKRDTHSFDE-----VRQSPYLCPLSLDRKA-- 559
            ..: ::......:|.|.:....:       .:.:.:.|...|     ::..|       :|.|  
plant    84 GNR-ILATKTVESRYPYVCLSEI-------PVKQPEIHGRPEGFKIAIKPRP-------NRGAGG 133

  Fly   560 ------------KSFEEREEDYDRARSRIFSRTGGNHDGYSGGGGDEECYGGWEQQQQQQKQSQP 612
                        :|.|||:|:||:||:|||:         |....|.|        ....:...|
plant   134 SGSGSGVEKNLLRSVEERKEEYDKARARIFN---------SPSSSDSE--------DSSTRAPPP 181

  Fly   613 PRPKRPNGKMLQMQNSTESRDGMRSGGAVPKSHN---FGNYGGPPSSGGPGNNSLPRGDSTNSIK 674
            |.|:      |..:::|          |.|..:.   ..||                  ::|.:.
plant   182 PYPR------LDSKHNT----------ACPSRNETEVVVNY------------------NSNPVD 212

  Fly   675 SGRGGFVKQDSTGSTPWRLSPSSSGYKTRTQSVRSDSVTPSPTGYGSDRQTPELNHPSMMSHSRV 739
            ..|.|.::              .||..:|...:|...         .||..|:.:.   ..:.||
plant   213 VERNGVIR--------------DSGRTSRVAIIRDRE---------KDRYDPDYDR---NRYVRV 251

  Fly   740 APPMSS 745
            |||:.:
plant   252 APPVQN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
encNP_001261376.1 R3H_encore_like 448..508 CDD:100071 18/66 (27%)
SUZ 527..578 CDD:289518 16/69 (23%)
AT5G05100NP_568149.1 R3H_encore_like 24..92 CDD:100071 18/69 (26%)
SUZ 120..164 CDD:403836 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15672
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.