DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enc and AT3G56680

DIOPT Version :9

Sequence 1:NP_001261376.1 Gene:enc / 44543 FlyBaseID:FBgn0004875 Length:1942 Species:Drosophila melanogaster
Sequence 2:NP_191227.1 Gene:AT3G56680 / 824835 AraportID:AT3G56680 Length:353 Species:Arabidopsis thaliana


Alignment Length:307 Identity:71/307 - (23%)
Similarity:119/307 - (38%) Gaps:74/307 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 DYGGTDLLVFFRDTLNKNPKDRNILLKIEKDLIDFVQE-NSRGCEYR-FPPASSYNRMLIHRTAA 490
            || |.::..|..:.|: |.:.|..:|::|.|:...:|. ..:..|:: ||  :||.|:..||.|.
plant    19 DY-GFNVDPFLVEALH-NSRHRLTILRMELDVQRLLQNPEQQQFEFQHFP--TSYLRLAAHRVAN 79

  Fly   491 FFGM-----EHNVDTETQQCVIVAVAKNTRIPEIRFQSLV--------RDDARK-SILKRDTHSF 541
            .:|:     |...|....: ::|.....::.|.:|...:.        :.::|| ||..|.:...
plant    80 HYGLATAVQESGADGNENR-ILVTKTTESKFPAVRLSEIPVAKQSENGKFESRKVSIKTRPSKGS 143

  Fly   542 D------EVRQSPYLCPLSLDRKAKSFEEREEDYDRARSRIFS-RTGGNHDGYSGGGGDEECYGG 599
            .      |..:.|          .:|.|||:|:||:||.|||| .||.:.|..|......|....
plant   144 GYGAGDLEKNRGP----------LRSVEERKEEYDKARERIFSGLTGLSCDDSSSETQVYERNAS 198

  Fly   600 WEQQQQQ--------QKQSQPPRPKRPNGKMLQMQNSTE-------SRDGMRSGGAVPKSHNFGN 649
            ..:..:|        .|::...|...|..::...::..:       .|...|...::|.:.||..
plant   199 LSRDDKQVSKNAYVEVKKNLSIRESGPTSRVAIFRDREKDRFDPDYDRRHQRYIRSLPVNQNFNL 263

  Fly   650 YGGPP-----------SSGGPGNNSLPR-------GDSTNSIKSGRG 678
               ||           ..|..|.|.:|.       |...:||.|..|
plant   264 ---PPFNIQQIPTPYYEMGFTGYNQIPSPPAPLGFGPHPSSIMSPYG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
encNP_001261376.1 R3H_encore_like 448..508 CDD:100071 17/66 (26%)
SUZ 527..578 CDD:289518 18/57 (32%)
AT3G56680NP_191227.1 R3H_encore_like 37..104 CDD:100071 18/69 (26%)
SUZ 129..177 CDD:372290 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15672
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.