DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment enc and AT2G40960

DIOPT Version :9

Sequence 1:NP_001261376.1 Gene:enc / 44543 FlyBaseID:FBgn0004875 Length:1942 Species:Drosophila melanogaster
Sequence 2:NP_001323751.1 Gene:AT2G40960 / 818696 AraportID:AT2G40960 Length:351 Species:Arabidopsis thaliana


Alignment Length:232 Identity:56/232 - (24%)
Similarity:96/232 - (41%) Gaps:60/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 KNPKDRNILLKIEKDLIDFVQE-NSRGCEYR-FPPASSYNRMLIHRTAAFFGMEHNV------DT 500
            :||:.|..:|::|.|:..|:|. :.:..|:: ||  :||.|...||.|..:|:..:|      ..
plant    30 QNPRHRLTILRMELDVQRFLQSPDQQQFEFQHFP--TSYLRFAAHRVANHYGLITSVRDGGADGN 92

  Fly   501 ETQQCVIVAVAKNTRIPEIRFQSLV-------RDDARKSILK-RDTHSF----DEVRQSPYLCPL 553
            |::  ::|..:.::|.|..|...:.       :.:..|.::| |.|...    ||::..      
plant    93 ESR--IVVTKSSDSRFPAARLSEIPVKQSETGKFEHMKVVIKPRPTKGSGMEGDELKGG------ 149

  Fly   554 SLDRKAKSFEEREEDYDRARSRIFSRTGGNHDGYSGGGGDEECYGGWEQQQQQQKQSQPPRPKRP 618
                ..||.|||:|||||||:|||:           |..:.:|          ...|....|.|.
plant   150 ----LLKSVEERKEDYDRARARIFN-----------GLVNIDC----------NDSSSETNPWRV 189

  Fly   619 NGKMLQMQNSTESRDGMRSGGAVPKSHNFGNYGGPPS 655
            |     ..:|.:....:::|......:|......|.|
plant   190 N-----CSSSRDENQVLKNGNIEADKNNISRKSNPAS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
encNP_001261376.1 R3H_encore_like 448..508 CDD:100071 18/67 (27%)
SUZ 527..578 CDD:289518 20/55 (36%)
AT2G40960NP_001323751.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15672
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.