DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and NKX6-2

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_796374.2 Gene:NKX6-2 / 84504 HGNCID:19321 Length:277 Species:Homo sapiens


Alignment Length:344 Identity:70/344 - (20%)
Similarity:105/344 - (30%) Gaps:126/344 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   744 SSTPTAAGNNNGSNNSS---------SNTNANSTAQLAASL-ASTLNGTKSLMQEDSNGLAAVAM 798
            ||.|.||.:|.....:|         :...|.:...|.|.| ..|.:|...::            
Human    12 SSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL------------ 64

  Fly   799 AAHAQHAAALGPGFLPGLPAFQFAAAQVA-----AGGDGRGHYRFADSELQLPPGASMAGR---L 855
               .:...|.|.|.|.|||.....|:...     |....||:.:         |.|.:.||   .
Human    65 ---GRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPK---------PLAELPGRPPIF 117

  Fly   856 GESLI---PKGDPMEAKLQEMLRYNMDKYANQALDTLHISRRVRELLSVHNIGQRLFA------- 910
            ...::   |..||         |......|...||.....:..|...|    ||::||       
Human   118 WPGVVQGAPWRDP---------RLAGPAPAGGVLDKDGKKKHSRPTFS----GQQIFALEKTFEQ 169

  Fly   911 -KYILGLSQGTVSELL----SKPKPWDKLTEKGRDSYRKMHAWACDDNAVMLLKSLIPKKDSGLP 970
             ||:.|..:..::..|    |:.|.|   .:..|..:||.||                       
Human   170 TKYLAGPERARLAYSLGMTESQVKVW---FQNRRTKWRKRHA----------------------- 208

  Fly   971 QYAGRGAGGAGGDDSMSEDRIAHILSEASSLMKQSSVAQHREQERRSHGGEDSHSNEDSKSPPQS 1035
                                    :..||:..||.|     :.|:...||.|: .::|..:.|..
Human   209 ------------------------VEMASAKKKQDS-----DAEKLKVGGSDA-EDDDEYNRPLD 243

  Fly  1036 CTSPFFKVENQLKQHQHLN 1054
            ..|...|:...||:|:..|
Human   244 PNSDDEKITRLLKKHKPSN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527 20/80 (25%)
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
NKX6-2NP_796374.2 Repressor domain. /evidence=ECO:0000250|UniProtKB:D3Z4R4 89..142 12/70 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..155 4/22 (18%)
Homeobox 151..204 CDD:306543 14/59 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.