DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and HB17

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_178252.2 Gene:HB17 / 814671 AraportID:AT2G01430 Length:275 Species:Arabidopsis thaliana


Alignment Length:167 Identity:44/167 - (26%)
Similarity:61/167 - (36%) Gaps:52/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1673 FIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQ---------DNSSDTSSNDTNDFYTS 1728
            :|:::::||:......:..|||             ||..         :|||:.....:...::|
plant    44 YIKLRVFLSNFTFSSSILALKN-------------PNNSLIKIMAILPENSSNLDLTISVPGFSS 95

  Fly  1729 SP--GPGSVGS------------------------GVGGAPPSKKQRVLFSEEQKEALRLAFALD 1767
            ||  ..||.|.                        ..|.|||.||.|:  :.||...|..:|..:
plant    96 SPLSDEGSGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRL--TREQSRLLEDSFRQN 158

  Fly  1768 PYPNVGTIEFLANELGLATRTITNWFHNHRMR--LKQ 1802
            ...|....|.||..|.|..|.|..||.|.|.|  |||
plant   159 HTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQ 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 3/16 (19%)
Homeobox 1749..1801 CDD:278475 18/53 (34%)
HB17NP_178252.2 HOX 136..192 CDD:197696 22/57 (39%)
HALZ 194..237 CDD:128634 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.