Sequence 1: | NP_524764.1 | Gene: | ct / 44540 | FlyBaseID: | FBgn0004198 | Length: | 2175 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055379.1 | Gene: | LHX3 / 8022 | HGNCID: | 6595 | Length: | 402 | Species: | Homo sapiens |
Alignment Length: | 221 | Identity: | 47/221 - (21%) |
---|---|---|---|
Similarity: | 70/221 - (31%) | Gaps: | 71/221 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1745 SKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHR---MRLKQQVPH 1806
Fly 1807 GPAGQ----------------DNPIPSRESTSATPF--------------------DPVQFRILL 1835
Fly 1836 QQRLLELHKERMGMS----------GAPIPYPPYFAAA-----------------AILGRSLAGI 1873
Fly 1874 PGA-----AAAAGAAAAAAAVGASGG 1894 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ct | NP_524764.1 | CUT | 886..955 | CDD:280527 | |
CUT | 1335..1411 | CDD:280527 | |||
CUT | 1616..1690 | CDD:280527 | |||
Homeobox | 1749..1801 | CDD:278475 | 18/54 (33%) | ||
LHX3 | NP_055379.1 | LIM1_Lhx3b | 33..87 | CDD:188851 | |
LIM2_Lhx3_Lhx4 | 95..150 | CDD:188762 | |||
Homeobox | 165..218 | CDD:278475 | 17/52 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |