DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and TRIP6

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_003293.2 Gene:TRIP6 / 7205 HGNCID:12311 Length:476 Species:Homo sapiens


Alignment Length:252 Identity:58/252 - (23%)
Similarity:78/252 - (30%) Gaps:88/252 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1095 ARTPRETAFPSFLFSPSLFGGAAGMPGAASNAFPAMADENMRHVFEREIAKLQQHQQQQQAAQAQ 1159
            ||.|:..|.|.         |..|.|.|..                   |.||.|.:        
Human    15 ARAPQGRAIPR---------GTPGPPPAHG-------------------AALQPHPR-------- 43

  Fly  1160 AQFPNFSSLMALQ-QQVLNGAQDLSLAAAAAKDIKLNGQRSSLEHSAGSSS-------CSKDGER 1216
               .||..|.:.| .|...|.:|...|..        |....|:|:.|..:       .|.|.|.
Human    44 ---VNFCPLPSEQCYQAPGGPEDRGPAWV--------GSHGVLQHTQGLPADRGGLRPGSLDAEI 97

  Fly  1217 D--DAYPSSLHGRKSEGGGTP-----APPAPPSGPGTGAGAPPTAAP----PTGG-------ASS 1263
            |  .:..:.|:|.:......|     .||.||: ..||:..|..|:|    |.||       .:|
Human    98 DLLSSTLAELNGGRGHASRRPDRQAYEPPPPPA-YRTGSLKPNPASPLPASPYGGPTPASYTTAS 161

  Fly  1264 NSAAPS-PLSNSILPPALSSQGEEFAATASPLQRMASITNSLITQPPVTPHHSTPQR 1319
            ..|.|: |:...:..|...         ..|.:|.||..:.    |...||...|.|
Human   162 TPAGPAFPVQVKVAQPVRG---------CGPPRRGASQASG----PLPGPHFPLPGR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
TRIP6NP_003293.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 25/124 (20%)
Atrophin-1 <8..251 CDD:331285 58/252 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..253 28/112 (25%)
LIM1_TRIP6 279..332 CDD:188736
LIM 339..398 CDD:295319
LIM3_Zyxin_like 399..461 CDD:188743
Interaction with MAGI1 and PTPN13. /evidence=ECO:0000269|PubMed:19017743 469..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.