DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ct and Nanog

DIOPT Version :9

Sequence 1:	NP_524764.1	Gene:	ct / 44540	FlyBaseID:	FBgn0004198	Length:	2175	Species:	Drosophila melanogaster
Sequence 2:	NP_082292.1	Gene:	Nanog / 71950	MGIID:	1919200	Length:	305	Species:	Mus musculus

Alignment Length:	109	Identity:	31/109 - (28%)
Similarity:	52/109 - (47%)	Gaps:	8/109 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly  1698 EASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSP----GPGSVGSGVGGAPPSKKQRVLFSEEQKE 1758
            ||:..|.|:.......|.|:|::.....  |||    ||....:.|  ....:|.|.:||:.|..
Mouse    49 EAASPRPSSEDLPLQGSPDSSTSPKQKL--SSPEADKGPEEEENKV--LARKQKMRTVFSQAQLC 109

  Fly  1759 ALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQ 1802
            ||:..|....|.::..::.|::.|.|:.:.:..||.|.||:.|:
Mouse   110 ALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKR 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ct	NP_524764.1	CUT	886..955	CDD:280527
		CUT	1335..1411	CDD:280527
		CUT	1616..1690	CDD:280527
		Homeobox	1749..1801	CDD:278475	16/51 (31%)
Nanog	NP_082292.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	46..95		13/49 (27%)
		Sufficient for interaction with SALL4. /evidence=ECO:0000269\|PubMed:16840789	96..155		18/58 (31%)
		HOX	96..152	CDD:197696	17/55 (31%)
		Required for DNA-binding. /evidence=ECO:0000250\|UniProtKB:Q9H9S0	123..152		8/28 (29%)
		10 X repeats starting with a Trp in each unit	198..247
		Sufficient for transactivation activity	198..247
		Sufficient for strong transactivation activity	248..305
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910