DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and LOC691325

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_001077719.1 Gene:LOC691325 / 691325 RGDID:1585091 Length:311 Species:Rattus norvegicus


Alignment Length:333 Identity:68/333 - (20%)
Similarity:110/333 - (33%) Gaps:101/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1653 SELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDT 1717
            |:|..:|. |::....|:.|.:..:..:..:.:|....|...|.:.:|:..:....:.:.....|
  Rat    23 SQLPQEPS-WNLAFQMGQSPLVTSRTPMQSSPSVPEQNLNWQESQGSSRESKPMALSDKHGGKQT 86

  Fly  1718 SSNDTNDFYTSSPGPGSVGSGVGGAPPSK--KQRVLFSEEQKEALRLAFALDPYPNVGTIEFLAN 1780
                                  |...|.|  |:|..:|.:||..|:..||...||:......||.
  Rat    87 ----------------------GPVAPRKCRKERTQYSAKQKSVLQEHFAECQYPDKKLCLELAT 129

  Fly  1781 ELGLATRTITNWFHNHRMRLKQQ-VPHG-PAGQDNPIPSRESTS-ATPFDPVQFRILLQQRLLEL 1842
            ..|:....|..||.|:|.:.||: ||.. |.....|    |:.| :|.|                
  Rat   130 LFGVTENEIKVWFKNNRAKCKQKNVPEALPETNGGP----EAVSWSTDF---------------- 174

  Fly  1843 HKERMGMSGAPIPYPPYFAAAAILGRSLAGIPGAAAAAGAAAAAAAVGASGGDELQALNQAFKEQ 1907
                                           ||:.|..|.            |:.:.:..|.   
  Rat   175 -------------------------------PGSIAVVGC------------DQGEPMATAI--- 193

  Fly  1908 MSGLDL-SMPTLKRERSDDYQDDLELEGGGHNLSDNESLEGQEPEDKTTDYEK--VLHKSALAAA 1969
               ||: |.|.|...:......:...:|....|.: :.|:|.:|.......|.  |..:|.||||
  Rat   194 ---LDVDSTPKLNCSQESSLDGNWTYDGAMCCLPE-DVLDGNDPVTAGDSGESAPVEAQSDLAAA 254

  Fly  1970 AAYMSNAV 1977
            .|.::.||
  Rat   255 GAPVAMAV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 7/36 (19%)
Homeobox 1749..1801 CDD:278475 17/51 (33%)
LOC691325XP_001077719.1 homeodomain 95..153 CDD:238039 20/57 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.