DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and SIX1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_005973.1 Gene:SIX1 / 6495 HGNCID:10887 Length:284 Species:Homo sapiens


Alignment Length:218 Identity:53/218 - (24%)
Similarity:77/218 - (35%) Gaps:57/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1642 EAVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASK---RR 1703
            :||:...:|:..||. |....|..| ....|.:: ||||. |:.||..:|.........|   ||
Human    53 KAVVAFHRGNFRELY-KILESHQFS-PHNHPKLQ-QLWLK-AHYVEAEKLRGRPLGAVGKYRVRR 113

  Fly  1704 RSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDP 1768
            :                        .|.|.::..|       ::....|.|:.:..||..:|.:|
Human   114 K------------------------FPLPRTIWDG-------EETSYCFKEKSRGVLREWYAHNP 147

  Fly  1769 YPNVGTIEFLANELGLATRTITNWFHNHRMR------------------LKQQVPHGPAGQDNPI 1815
            ||:......||...||.|..::|||.|.|.|                  ..:|....|.....|:
Human   148 YPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLEGGKPL 212

  Fly  1816 -PSRESTSATPFDPVQFRILLQQ 1837
             .|.|...:.|..|.|..:||.|
Human   213 MSSSEEEFSPPQSPDQNSVLLLQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 16/47 (34%)
Homeobox 1749..1801 CDD:278475 19/69 (28%)
SIX1NP_005973.1 SIX1_SD 9..118 CDD:374862 21/92 (23%)
homeodomain 129..180 CDD:238039 19/50 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..269 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.