DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and SHOX

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_000442.1 Gene:SHOX / 6473 HGNCID:10853 Length:292 Species:Homo sapiens


Alignment Length:158 Identity:42/158 - (26%)
Similarity:62/158 - (39%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1746 KKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQ------- 1803
            ::.|..|:.||...|...|....||:....|.|:..|||:...:..||.|.|.:.::|       
Human   118 RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKG 182

  Fly  1804 -----VPHGPAGQDNPIPSRESTSATPFDPVQFRILLQQRLLELHKERMGMSGAPIPY----PPY 1859
                 ..|..|.:..|..:. .....||..||.::.| :.:...|........|..||    ||.
Human   183 VILGTANHLDACRVAPYVNM-GALRMPFQQVQAQLQL-EGVAHAHPHLHPHLAAHAPYLMFPPPP 245

  Fly  1860 FAAAAILGRSLAGIPGAAAAAGAAAAAA 1887
            |      |..:|.:..:|:||...||||
Human   246 F------GLPIASLAESASAAAVVAAAA 267

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 17/51 (33%)
SHOXNP_000442.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34