powered by:
Protein Alignment ct and Isl1
DIOPT Version :9
Sequence 1: | NP_524764.1 |
Gene: | ct / 44540 |
FlyBaseID: | FBgn0004198 |
Length: | 2175 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_059035.3 |
Gene: | Isl1 / 64444 |
RGDID: | 61957 |
Length: | 349 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 25/75 - (33%) |
Similarity: | 35/75 - (46%) |
Gaps: | 12/75 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1744 PSKKQRV--LFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMR------- 1799
|.|..|| :.:|:|...||..:|.:|.|:....|.|....||:.|.|..||.|.|.:
Rat 178 PEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIM 242
Fly 1800 ---LKQQVPH 1806
|:||.|:
Rat 243 MKQLQQQQPN 252
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.