DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and AgaP_AGAP011253

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_001688185.1 Gene:AgaP_AGAP011253 / 5667880 VectorBaseID:AGAP011253 Length:401 Species:Anopheles gambiae


Alignment Length:342 Identity:84/342 - (24%)
Similarity:124/342 - (36%) Gaps:83/342 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1504 QQQAQQHLQQQQHLAQQQHPHQ-------QHHQAAAAAAALHHQSMLLTSPGLPPQHAISLPPSA 1561
            |:..:.|:.....|..|||.||       |...|:.:::.|..|.. .|.|.|......|.|...
Mosquito    63 QRSQRFHISNILELNNQQHQHQDQPATKDQPSVASLSSSTLESQQH-ATQPSLDVTAPTSYPDDQ 126

  Fly  1562 GGAQPGGPGGNQ-GSSNPSNSEKKPMLMPVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTK 1625
            ..|.|.|...:| .|..|        |.||...:|:.:...:..|..|..               
Mosquito   127 SAALPYGTMSSQTASCLP--------LQPVLNPSAIGTGIPYDPPPYYSY--------------- 168

  Fly  1626 IKEALLANNIGQKIF--GEAVLGLSQGSVSELLSKPKPWH---------------MLSIKGREPF 1673
                   ::....:|  |.|.|| |.|.|||   .|:..:               .||.....| 
Mosquito   169 -------SHHAHHLFGGGSAALG-SSGVVSE---PPRSSYSYGGVNLDYANSSNQQLSPDSTSP- 221

  Fly  1674 IRMQLW-LSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYT--------SS 1729
             ..:|: |:..:|:.|   :.||..:......|.||:.....|..::|:.|:.:|        .|
Mosquito   222 -GPELYSLASYSNIPR---VVNEASDRLVALESDGPSLDPECSVDTNNNNNNHHTPDDTPDDLDS 282

  Fly  1730 PGP---------GSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLA 1785
            |||         |..|.|.||....:|:|:|||:.|...|...|....|.:....|.||:.:.|.
Mosquito   283 PGPRASRSGGHRGESGCGTGGGHKKRKRRILFSKSQTFELERRFKQARYLSAPEREHLASMINLT 347

  Fly  1786 TRTITNWFHNHRMRLKQ 1802
            ...:..||.|||.:.|:
Mosquito   348 PTQVKIWFQNHRYKTKR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 18/91 (20%)
Homeobox 1749..1801 CDD:278475 17/51 (33%)
AgaP_AGAP011253XP_001688185.1 Homeobox 310..363 CDD:278475 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.