DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and BARX1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_067545.3 Gene:BARX1 / 56033 HGNCID:955 Length:254 Species:Homo sapiens


Alignment Length:314 Identity:63/314 - (20%)
Similarity:99/314 - (31%) Gaps:105/314 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1552 QHAISLPPSAGGAQPGGPGGNQGSSNPSNSEKKPMLMPVHGTNAMRSLHQHMSPTVYEMAALTQD 1616
            :..::.||...||.|.......|         :.:...|....|.|..|.|::....|.||:.: 
Human    32 EEILTEPPGPKGAAPAAAAAAAG---------ELLKFGVQALLAARPFHSHLAVLKAEQAAVFK- 86

  Fly  1617 LDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKGR--EPFIRMQLW 1679
                                   |..|.||.|..|.:.|.:.|      .:.|.  .|.:.::|.
Human    87 -----------------------FPLAPLGCSGLSSALLAAGP------GLPGAAGAPHLPLELQ 122

  Fly  1680 LSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPP 1744
            |             ..:.||:                              |||..|:   .|..
Human   123 L-------------RGKLEAA------------------------------GPGEPGT---KAKK 141

  Fly  1745 SKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPA 1809
            .::.|.:|:|.|...|...|....|.:......||..|||:...:..|:.|.||:.|:.|..| .
Human   142 GRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQG-G 205

  Fly  1810 GQDNPI-----PSRESTSATPFDPVQFRILLQQRLLELHKERMGMSGAPIPYPP 1858
            |.::|.     |.:.|.      |...::..|:|..:..|.      |.:|..|
Human   206 GLESPTKPKGRPKKNSI------PTSEQLTEQERAKDAEKP------AEVPGEP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 12/75 (16%)
Homeobox 1749..1801 CDD:278475 16/51 (31%)
BARX1NP_067545.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Homeobox 145..199 CDD:395001 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254 12/57 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.