DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and lmx1ba

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001349521.1 Gene:lmx1ba / 554361 ZFINID:ZDB-GENE-050114-3 Length:375 Species:Danio rerio


Alignment Length:181 Identity:45/181 - (24%)
Similarity:69/181 - (38%) Gaps:28/181 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1690 QLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPS-----KKQR 1749
            |||.....|..|...|  |:..|  ||.|.::..|.   .|..|:.|.|.|.....     |:.|
Zfish   139 QLLCKTDY
EREKDLAS--PDLSD--SDKSEDEDLDV---KPEKGAGGQGKGSDDSKDPRRPKRPR 196

  Fly  1750 VLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNP 1814
            .:.:.:|:.|.:.:|.:...|.....|.||.|.||:.|.:..||.|.|.::|:........|:..
Zfish   197 TILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQEQQ 261

  Fly  1815 IPSRESTSATPFDPVQFRILLQQRLLELHKERMGMSGAPIPYPPYFAAAAI 1865
            ...|                |.|.::....|.:..|..|:..||..|..::
Zfish   262 NSQR----------------LGQDVMSSRMENLMSSYTPLAPPPPHALVSM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 45/181 (25%)
Homeobox 1749..1801 CDD:278475 16/51 (31%)
lmx1baNP_001349521.1 LIM1_Lmx1b 33..85 CDD:188757
LIM 92..146 CDD:295319 3/6 (50%)
Homeobox 195..248 CDD:306543 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.