DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and lhx5

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001016082.1 Gene:lhx5 / 548836 XenbaseID:XB-GENE-490400 Length:402 Species:Xenopus tropicalis


Alignment Length:326 Identity:72/326 - (22%)
Similarity:107/326 - (32%) Gaps:114/326 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1640 FGEAVLGLSQG-SVSELLSKP--KPWHM----LSIKGREPFIRMQLWLSDANNVERLQLLKNERR 1697
            ||....|.|.| |.|:|:.|.  |.:|:    ..:..::.....:|::.|.|..    :.|.:..
 Frog    60 FGTKCAGCSLGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYIIDENKF----VCKEDYA 120

  Fly  1698 EASKRR------------RSTGPNQ----QDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSK 1746
            .||..:            ||..|:.    ||.|.:|..:.::|..|::.......||.....|  
 Frog   121 SASSLKESSLNSVSSCTDRSLSPDLQDPIQDESKETDHSTSSDKETANNENEEQNSGTKRRGP-- 183

  Fly  1747 KQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHR---MRLKQQ----- 1803
              |.....:|.|.|:.|||..|.|.....|.||.|.||..|.|..||.|.|   .|:||.     
 Frog   184 --RTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGA 246

  Fly  1804 ------------------------------------------------VPHGPAGQDNPIPSRES 1820
                                                            .||||.......|:..|
 Frog   247 RRHAFFRSPRRMRPLGGRLDESDILSSGPYSYYGDYQGDYYGSGNYDFFPHGPPSSQTQSPADSS 311

  Fly  1821 ------TSATPFDPVQFRI-----LLQQRLLEL--HKE----RMGMSGA--PI--------PYPP 1858
                  ..:||..|::.::     ...||..::  |.:    ...|:|:  ||        |.||
 Frog   312 YLQNSGPGSTPLGPLESQLSGHHPSENQRYADMISHPDTPSPEPSMTGSLHPISGEVFSGGPSPP 376

  Fly  1859 Y 1859
            :
 Frog   377 F 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 14/56 (25%)
Homeobox 1749..1801 CDD:278475 22/54 (41%)
lhx5NP_001016082.1 LIM1_Lhx1_Lhx5 5..56 CDD:188753
LIM2_Lhx1_Lhx5 64..119 CDD:188761 13/58 (22%)
Homeobox 183..237 CDD:365835 22/57 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.