DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ct and PITX1

DIOPT Version :9

Sequence 1:	NP_524764.1	Gene:	ct / 44540	FlyBaseID:	FBgn0004198	Length:	2175	Species:	Drosophila melanogaster
Sequence 2:	NP_002644.4	Gene:	PITX1 / 5307	HGNCID:	9004	Length:	314	Species:	Homo sapiens

Alignment Length:	113	Identity:	32/113 - (28%)
Similarity:	52/113 - (46%)	Gaps:	13/113 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly  1704 RSTGPNQQDNSSDTSSNDT----NDFYTSSPGP---GSVGSGVGGA-PPSKK-----QRVLFSEE 1755
            |...|.:...:|.:.|:||    .:......||   |:.|:|.||| .|:||     ||..|:.:
Human    35 RPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQ 99

  Fly  1756 QKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQ 1803
            |.:.|...|..:.||::...|.:|....|....:..||.|.|.:.:::
Human   100 QLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKR 147

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ct	NP_524764.1	CUT	886..955	CDD:280527
		CUT	1335..1411	CDD:280527
		CUT	1616..1690	CDD:280527
		Homeobox	1749..1801	CDD:278475	14/51 (27%)
PITX1	NP_002644.4	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..103		21/67 (31%)
		COG5576	36..>146	CDD:227863	31/109 (28%)
		Homeobox	93..146	CDD:395001	14/52 (27%)
		Interaction with PIT-1. /evidence=ECO:0000250	147..279		0/1 (0%)
		OAR	276..293	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	280..293
		Nuclear localization signal. /evidence=ECO:0000255	286..290
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910