DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and PBX1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_005245285.1 Gene:PBX1 / 5087 HGNCID:8632 Length:486 Species:Homo sapiens


Alignment Length:623 Identity:107/623 - (17%)
Similarity:193/623 - (30%) Gaps:228/623 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1462 PAQAQHLMQQMQAAAMSAAMQQ------QQVAQAQQQAQQAQQAQQH------------------ 1502
            |..:|||.............:|      ||:.....|:....||::|                  
Human    20 PGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEI 84

  Fly  1503 -----LQQQAQQHLQQQQHLAQQQHPHQQHHQAAAAAAA--------LHH--------------- 1539
                 |::...::......|..:.....:|...::|:.:        .||               
Human    85 KEKTELKEARSRNCPSLFFLVTRIQSSVRHRVLSSASTSGNPVTPQPTHHHPSFGWGEGKVLSIR 149

  Fly  1540 --QSMLLTSPGLPPQHAISLPPSAGGAQPGG----------PGGNQGSSNP-SNSEKKPMLMPVH 1591
              |....|.|.|.....:.|.....|.:.||          ..|..||.|. .:|:.:..|    
Human   150 GAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKL---- 210

  Fly  1592 GTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELL 1656
              :.:|.:: |.....||.|.       ::.||.:...                 |.:.|.:..:
Human   211 --SQIRQIY-HTELEKYEQAC-------NEFTTHVMNL-----------------LREQSRTRPI 248

  Fly  1657 SKPKPWHMLSIKGRE-PFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSN 1720
            |..:...|:||..|: ..|:|||   ..:..|.:.:|::...:|.::||        |.:..::.
Human   249 SPKEIERMVSIIHRKFSSIQMQL---KQSTCEAVMILRSRFLDARRKRR--------NFNKQATE 302

  Fly  1721 DTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLA 1785
            ..|:::.|                                   ...:|||:....|.||.:.|:.
Human   303 ILNEYFYS-----------------------------------HLSNPYPSEEAKEELAKKCGIT 332

  Fly  1786 TRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSRESTSATPFDPVQFRILLQQRLLELHKERMGMS 1850
            ...::|||.|.|:|.|:.:  |...::..|                                   
Human   333 VSQVSNWFGNKRIRYKKNI--GKFQEEANI----------------------------------- 360

  Fly  1851 GAPIPYPPYFAAAAILGRSLAGIPGAAAAAGAAAAAAAVGASGGDELQALNQAFKEQMSGLDLSM 1915
                    |.|..|:...::       :|.|:.|.:.:...|.|.     :.:|....|| ||.|
Human   361 --------YAAKTAVTATNV-------SAHGSQANSPSTPNSAGS-----SSSFNMSNSG-DLFM 404

  Fly  1916 PTLKRERSDDYQDDLELEGGGHNLSDNESLEGQEPEDKTTDYEKVLHKSALAAAAAYMSNAVRSS 1980
             :::....|.||.   .:.|.:..|..::|  :....:|..|     ...|||:..|        
Human   405 -SVQSLNGDSYQG---AQVGANVQSQVDTL--RHVISQTGGY-----SDGLAASQMY-------- 450

  Fly  1981 RRKPAAPQWVNPAGA---VTNPSAVVAAVAAAAAAAAD 2015
                 :||.::..|.   .|.||:|.:......:..:|
Human   451 -----SPQGISANGGWQDATTPSSVTSPTEGPGSVHSD 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 14/74 (19%)
Homeobox 1749..1801 CDD:278475 13/51 (25%)
PBX1XP_005245285.1 PBC 40..288 CDD:281746 47/281 (17%)
homeodomain 290..350 CDD:238039 19/102 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.