DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and PAX6

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens


Alignment Length:446 Identity:90/446 - (20%)
Similarity:137/446 - (30%) Gaps:170/446 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1518 AQQQHPHQQHHQAA-----AAAAALHHQSMLLTSPGLPPQHAISLPPSAGGAQPGGPGGNQGSSN 1577
            :|.||..|....:|     |.|.|....::.||..|   :..:.|.||.|.......||:.|.:.
Human    30 SQSQHAEQGGRSSAAEIKRAVAGANRLPALSLTCGG---RTCLWLKPSPGSDSHVCTGGHSGVNQ 91

  Fly  1578 PSNSEKKPMLMPVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGE 1642
            ...       :.|:|.....|..|                       ||.|  ||::..:.....
Human    92 LGG-------VFVNGRPLPDSTRQ-----------------------KIVE--LAHSGARPCDIS 124

  Fly  1643 AVLGLSQGSVSELLS--------KPKPWHMLSIKGREPFIRMQLWLSDANNVERLQLLKNE---- 1695
            .:|.:|.|.||::|.        :|:     :|.|.:|.:      :....|.::...|.|    
Human   125 RILQVSNGCVSKILGRYYETGSIRPR-----AIGGSKPRV------ATPEVVSKIAQYKRECPSI 178

  Fly  1696 -RREASKRRRSTGPNQQDNSSDTSS---------------------------NDTNDFYTSSPG- 1731
             ..|...|..|.|....||....||                           |.....:.:.|| 
Human   179 FAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGW 243

  Fly  1732 -PGSVGSGVGGAPPS------------------------------------KKQRVLFSEEQKEA 1759
             |   |:.|.|.|..                                    ::.|..|::||.||
Human   244 YP---GTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEA 305

  Fly  1760 LRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMR---------LKQQVPHGPAGQDNPI 1815
            |...|....||:|...|.||.::.|....|..||.|.|.:         .::|..:.|    :.|
Human   306 LEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTP----SHI 366

  Fly  1816 PSRESTSATPFDPVQFRILLQQRLLELHKERMGMSGAPIPYPPY--FAAAAILGRS 1869
            |...|.|.:.:.|:                       |.|..|.  |.:.::|||:
Human   367 PISSSFSTSVYQPI-----------------------PQPTTPVSSFTSGSMLGRT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 16/81 (20%)
Homeobox 1749..1801 CDD:278475 20/60 (33%)
PAX6NP_001355839.1 PAX 85..209 CDD:128645 32/166 (19%)
Homeobox 295..348 CDD:395001 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.