DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and AgaP_AGAP001495

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_001238516.3 Gene:AgaP_AGAP001495 / 4577217 VectorBaseID:AGAP001495 Length:230 Species:Anopheles gambiae


Alignment Length:236 Identity:53/236 - (22%)
Similarity:77/236 - (32%) Gaps:79/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1736 GSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRL 1800
            |.....|...::.|..|:..|.|.|..||:...||:|...|.||..|.|....:..||.|.|.:.
Mosquito    12 GDDESSASKRRRSRTNFNSWQLEELERAFSASHYPDVFMREALAMRLDLKESRVAVWFQNRRAKW 76

  Fly  1801 KQQVPHGPAGQDNPIPSRESTSATPFDPVQFRILLQQRLLELHKERMGMSGAPIPYPPYFAAAAI 1865
            ::: .|...|     |.|.:.:|.|                     ...||.|||          
Mosquito    77 RKK-EHTKKG-----PGRPAHNAHP---------------------QSCSGEPIP---------- 104

  Fly  1866 LGRSLAGIPGAAAAAGAAAAAAAVGASGGDELQAL-NQAFKEQMSGLDLSMPTLKRE-------- 1921
                    |....|...|.....:.       :|| .||.|.:..|:.:.:..||.|        
Mosquito   105 --------PSELRAREKARRRKKIA-------KALERQARKLRAKGITVDLEALKAEYLSQHRNN 154

  Fly  1922 ----------RSDDYQDDLELEGGGHNLSDNESLEGQEPED 1952
                      ..:|.:|.:::.||..:        |.||||
Mosquito   155 SGSDSEDDDDNDNDDEDPIDVVGGAES--------GDEPED 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 19/51 (37%)
AgaP_AGAP001495XP_001238516.3 Homeobox 26..77 CDD:278475 18/50 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.