DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and C15

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:338 Identity:76/338 - (22%)
Similarity:131/338 - (38%) Gaps:83/338 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 NSHQDEEELDDEEEDEEEDEDEDDEEENASMQSNA-------DDMELD---AQQETRTEPSATTQ 321
            :||::    ||.|.:.|..|:.:::|.:..:.|::       .|:::|   ...|:.|..|.:.|
  Fly     2 SSHEE----DDHEHENEHGEEVEEQEIHVDVDSDSRMSCGSGSDVDMDGGSCYDESETPLSESLQ 62

  Fly   322 -QQHQQQDTEDLE------ENKDAGEASLNVSNNHNTTDSNNSCSRKNNNGGNESEQHVASSAED 379
             :|.:...:|:|.      .:|....:..:.:||::...|:...|..|||.|.:.|:......||
  Fly    63 SEQTRSSSSENLPFSISRLLSKPFETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQED 127

  Fly   380 DDCANNNTNTSNNNNTSNTATSNTNNNNNNNSSSGNSEKRKKKNNNNNNGQP----------AVL 434
            .|.| ....||..|:|..:|.:..:..:...|::|....|......     |          |.|
  Fly   128 HDLA-YKLATSIANSTYGSAAALYSYPHLYPSAAGGHVLRVPPQRT-----PLTWALPPLHHAAL 186

  Fly   435 L--AAKDKEIKALLDELQRL-----------RAQEQTHLVQIQRLEEHLEVKRQHIIRLEARLDK 486
            .  |.||: :.|.....:|:           |.:.:|...:||            :..||.|..|
  Fly   187 AHQAVKDR-LAAAFPIARRIGHPYQNRTPPKRKKPRTSFTRIQ------------VAELEKRFHK 238

  Fly   487 QQINEALAEATALS-------AAASTNNNN-----NSQSSDNNKKLNTAAERPM-----DASSNA 534
            |:. .|.||..||:       |...|...|     ..|:::..:....||.|.|     :|.|..
  Fly   239 QKY-LASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKG 302

  Fly   535 DLPESTKAPVPAE 547
            ..|.|  ||:.::
  Fly   303 FAPPS--APLGSQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
C15NP_476873.2 COG5576 <196..315 CDD:227863 30/133 (23%)
Homeobox 220..273 CDD:278475 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.