DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and tin

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_524433.1 Gene:tin / 42536 FlyBaseID:FBgn0004110 Length:416 Species:Drosophila melanogaster


Alignment Length:445 Identity:107/445 - (24%)
Similarity:151/445 - (33%) Gaps:129/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1429 YSGSPQMPQGLASKMQAASLPMQ-----KMMSELKLQEPAQAQHLMQQMQAAAMSAAMQQQQVAQ 1488
            |:.||. |..|.:.....:.|..     .|:::.:..|.:.. |:.....|:|:.|         
  Fly    18 YTQSPS-PGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYG-HIDGAATASALFA--------- 71

  Fly  1489 AQQQAQQAQQAQQHLQQQAQQHLQQQQHLAQQQHPHQQHHQAAAAAAALHHQSMLLTSPGLPPQH 1553
                |.:.|...|:|..  |||.|.:..:.|||..||.....|..:::|        ||.|||  
  Fly    72 ----AGEYQNPHQYLNH--QQHQQSELPIPQQQLHHQHLDDGATTSSSL--------SPLLPP-- 120

  Fly  1554 AISLPPSA--GGAQPGGPGGNQGSSNPSNSEKKPMLMPVHGTNAMRSLHQHMSP--------TVY 1608
                ||..  ||.|..|                   ||.|     ...|.|..|        :.|
  Fly   121 ----PPHQLYGGYQDYG-------------------MPAH-----MFQHHHGHPHQSFQHSASAY 157

  Fly  1609 EMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSV---SELLSKPKPWHMLSIKGR 1670
            .|:| :|.......|.....|....|....  ||...|.:..:|   ||.:  |.|:...|    
  Fly   158 NMSA-SQFYAGASATAYQTPATYNYNYAGS--GEVYGGATPSAVGIKSEYI--PTPYVTPS---- 213

  Fly  1671 EPFIRMQLWLSDANNVERLQ--------------LLKNERREASKRR---RSTGPNQQDNSSDTS 1718
                 ..|.|:.:..|:.||              |::.....:|.|.   ...|..::|||..||
  Fly   214 -----PTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTS 273

  Fly  1719 SND---TNDFYTSSPGPGSVGSGVGGAPP--SKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFL 1778
            |..   .|    |..|..:.||..|...|  .:|.|||||:.|...|...|.|..|......|.:
  Fly   274 SRSELRKN----SISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREII 334

  Fly  1779 ANELGLATRTITNWFHNHR----------------MRLKQQVPHGPAGQDNPIPS 1817
            |.:|.|:...:..||.|.|                ::||.:....|.....|||:
  Fly   335 AQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 15/76 (20%)
Homeobox 1749..1801 CDD:278475 18/67 (27%)
tinNP_524433.1 HOX 301..357 CDD:197696 19/55 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.