DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and MEOX2

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_005915.2 Gene:MEOX2 / 4223 HGNCID:7014 Length:304 Species:Homo sapiens


Alignment Length:315 Identity:69/315 - (21%)
Similarity:93/315 - (29%) Gaps:135/315 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1507 AQQHLQQQQHLAQQQHPHQQHHQAAAAAAALHHQSM-------LLTSPGLPPQHAISLPPSAGGA 1564
            |.||.:...|  ...|.|..|||..      .||::       .::||....:|::.|.|.:||.
Human    61 ASQHHRGHHH--HHHHHHHHHHQQQ------QHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGP 117

  Fly  1565 QPGGPGGNQGSSNP---SNSEKKPMLMPVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTKI 1626
            .      ..|||.|   |||.......|.....|         |..|                  
Human   118 P------ELGSSPPVLCSNSSSLGSSTPTGAACA---------PGDY------------------ 149

  Fly  1627 KEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVERLQL 1691
                                                      ||:.       ||.|        
Human   150 ------------------------------------------GRQA-------LSPA-------- 157

  Fly  1692 LKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQ 1756
                  ||.||   :|..::.:|||:..             |:..|.|...|  :|:|..|::||
Human   158 ------EAEKR---SGGKRKSDSSDSQE-------------GNYKSEVNSKP--RKERTAFTKEQ 198

  Fly  1757 KEALRLAFALDPY-PNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAG 1810
            ...|...||...| ..:...|...| |.|..|.:..||.|.||:.| :|..|..|
Human   199 IRELEAEFAHHNYLTRLRRYEIAVN-LDLTERQVKVWFQNRRMKWK-RVKGGQQG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 5/73 (7%)
Homeobox 1749..1801 CDD:278475 18/52 (35%)
MEOX2NP_005915.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..192 46/250 (18%)
COG5576 160..284 CDD:227863 33/112 (29%)
Homeobox 191..243 CDD:278475 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.