DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and Pbx2

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001002828.1 Gene:Pbx2 / 406164 RGDID:1303084 Length:430 Species:Rattus norvegicus


Alignment Length:496 Identity:94/496 - (18%)
Similarity:149/496 - (30%) Gaps:207/496 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1550 PPQHAISLPPSAG-------GAQPGGPGGNQGSSNPSNSE--------KKPM------LMPV--- 1590
            ||      ||..|       |.:|||||...|..:|....        |:.:      :|.:   
  Rat     8 PP------PPGGGRGGLGLVGGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQIMTITDQ 66

  Fly  1591 ---------HGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITT------------KIKEALLANN 1634
                     |..|..|     |.|.::.:....::.....|.:            ::...|||..
  Rat    67 SLDEAQAKKHALNCHR-----MKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDNMLLAEG 126

  Fly  1635 I------GQKIFGEAVLGLSQGSVS---------------------------------------- 1653
            :      |......|....|.|.||                                        
  Rat   127 VAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVM 191

  Fly  1654 ELL---SKPKP------WHMLSIKGRE-PFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGP 1708
            .||   |:.:|      ..|:||..|: ..|:|||   ..:..|.:.:|::...:|.::||    
  Rat   192 NLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQL---KQSTCEAVMILRSRFLDARRKRR---- 249

  Fly  1709 NQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVG 1773
                |.|..::...|:::.|                                   ...:|||:..
  Rat   250 ----NFSKQATEVLNEYFYS-----------------------------------HLSNPYPSEE 275

  Fly  1774 TIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSRESTSATPFDPVQFRILLQQR 1838
            ..|.||.:.|:....::|||.|.|:|.|:.:  |...::..|.:           |:..:.:.|.
  Rat   276 AKEELAKKCGITVSQVSNWFGNKRIRYKKNI--GKFQEEANIYA-----------VKTAVSVAQG 327

  Fly  1839 LLELHKERMGMSGAPIPYPPYFAAAAILGRSLAGIPGAAAAAGAAAAAAAVGASGGDELQALNQA 1903
                     |.|....|.||          |.||..|:...:|:......:....||...|    
  Rat   328 ---------GHSRTSSPTPP----------SSAGSGGSFNLSGSGDMFLGMPGLNGDSYPA---- 369

  Fly  1904 FKEQMSGLDLSM-PTLKRERSDDYQDDLELEGGGHNLSDNE 1943
              .|:..|..|| |.       .|.|::   |||...|..|
  Rat   370 --SQVESLRHSMGPA-------SYGDNI---GGGQIYSPRE 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 23/141 (16%)
Homeobox 1749..1801 CDD:278475 13/51 (25%)
Pbx2NP_001002828.1 PBC 50..243 CDD:281746 31/200 (16%)
homeodomain 245..305 CDD:238039 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.