DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and LMO1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_006718291.1 Gene:LMO1 / 4004 HGNCID:6641 Length:193 Species:Homo sapiens


Alignment Length:169 Identity:39/169 - (23%)
Similarity:61/169 - (36%) Gaps:53/169 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   810 PGFLPGLPAFQFAAAQVAAGGDGRGHYRFADSELQLPP----------GASMAGRLGESLIPKGD 864
            |.:||              .|:.||.   |.|:|:|..          |.:..|....|:.|||.
Human    10 PQWLP--------------AGEPRGR---AWSDLELGEVDVLGWKSGLGGAHWGVPMLSVQPKGK 57

  Fly   865 P-----MEAKLQEMLRY---NMDKYANQ-ALDTLHISRRVRELLSVHNIGQRLFAKYILGLSQ-- 918
            .     ...|:::  ||   .:|||.:: .|.......|:.|      :|..|:.|..|.|.:  
Human    58 QKGCAGCNRKIKD--RYLLKALDKYWHEDCLKCACCDCRLGE------VGSTLYTKANLILCRRD 114

  Fly   919 -----GTVSE--LLSKPKPWDKLTEKGRDSYRKMHAWAC 950
                 ||...  ..||..|..::..:.||:...:..:||
Human   115 YLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFAC 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527 17/74 (23%)
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
LMO1XP_006718291.1 LIM1_LMO1_LMO3 61..115 CDD:188774 14/61 (23%)
LIM2_LMO1_LMO3 125..179 CDD:188775 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.