DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and LIMK1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_002305.1 Gene:LIMK1 / 3984 HGNCID:6613 Length:647 Species:Homo sapiens


Alignment Length:368 Identity:73/368 - (19%)
Similarity:116/368 - (31%) Gaps:125/368 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1540 QSMLLTSPGLPPQHAISLPPSAGGAQPGGPGGNQGSSNPSNSEKKPMLMPVHGTNAMRSLHQHMS 1604
            :.:|..|||....|.::|.     :.|....|.:|.|        ..:.|.||.....:.|.|  
Human   148 EQILPDSPGSHLPHTVTLV-----SIPASSHGKRGLS--------VSIDPPHGPPGCGTEHSH-- 197

  Fly  1605 PTVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWHMLSIKG 1669
                  ....|.:|...::..:|.::   ::|.:|                         |.|.|
Human   198 ------TVRVQGVDPGCMSPDVKNSI---HVGDRI-------------------------LEING 228

  Fly  1670 ----REPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSP 1730
                ..|...:.|.:.:.:.:.:|.|   |...........||.....||..        ||.| 
Human   229 TPIRNVPLDEIDLLIQETSRLLQLTL---EHDPHDTLGHGLGPETSPLSSPA--------YTPS- 281

  Fly  1731 GPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLAN---ELGLATRTITNW 1792
              |..||               |..||..|| :.::|..|..|::...|:   :|| .:.::...
Human   282 --GEAGS---------------SARQKPVLR-SCSIDRSPGAGSLGSPASQRKDLG-RSESLRVV 327

  Fly  1793 FHNHRMRLKQQVPHGPA------GQDNPIPSRES------TSATPFDPVQFRILLQQ----RLLE 1841
            ...||:.....:.||..      ||...:..||:      .....||....|..|::    |.||
Human   328 CRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLE 392

  Fly  1842 ----------LHKE-RMGMSGAPIPYPPYFAAAAILGRSLAGI 1873
                      |:|: |:.           |....|.|.:|.||
Human   393 HPNVLKFIGVLYKDKRLN-----------FITEYIKGGTLRGI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 9/77 (12%)
Homeobox 1749..1801 CDD:278475 13/54 (24%)
LIMK1NP_002305.1 LIM1_LIMK1 5..77 CDD:188846
LIM 84..138 CDD:295319
PDZ 165..255 CDD:278991 22/141 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..319 19/85 (22%)
STKc_LIMK1 345..611 CDD:271123 20/91 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.