DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and msx1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001032329.1 Gene:msx1 / 394692 XenbaseID:XB-GENE-490378 Length:275 Species:Xenopus tropicalis


Alignment Length:300 Identity:60/300 - (20%)
Similarity:89/300 - (29%) Gaps:124/300 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly  1619 THDITTKIKEALLANNI--GQKI-FGE---AVLGLSQGSVSELLSKPKPWHMLSIKGREPFIRMQ 1677
            |:....|::|:...|.:  |.|: .||   .|.|:...||..|::..||       |||      
 Frog     9 TYQPGVKVEESPSVNKMQTGLKVALGEDKPKVPGILPFSVEALMADRKP-------GRE------ 60

  Fly  1678 LWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGS--GVG 1740
               .|.::.....|.....   |.|..|..|.:..||                 |.|:|:  .||
 Frog    61 ---RDLSSPTGSPLAGTSH---SPRVGSLAPGETPNS-----------------PISIGNRFPVG 102

  Fly  1741 G----------------------------------APP---------SKKQRVLFSEEQKEALRL 1762
            |                                  :||         ::|.|..|:..|..||..
 Frog   103 GIMKLPEEALVKPESPERSSWIQSPRFSPSPTRRMSPPACTLRKHKTNRKPRTPFTTSQLLALER 167

  Fly  1763 AFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSRESTSATPFD 1827
            .|....|.::......::.|.|....:..||.|.|.:.|                          
 Frog   168 KFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAK-------------------------- 206

  Fly  1828 PVQFRILLQQRLLELHKERMGMSGAPIPYPPYFAAAAILG 1867
                      ||.|...|::.|:..|: .||.|..:..||
 Frog   207 ----------RLQEAELEKLKMAAKPM-LPPAFGISFPLG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 19/76 (25%)
Homeobox 1749..1801 CDD:278475 13/51 (25%)
msx1NP_001032329.1 PTZ00449 <55..>259 CDD:185628 46/253 (18%)
Homeobox 153..207 CDD:365835 14/89 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.