DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and CG9876

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:248 Identity:57/248 - (22%)
Similarity:88/248 - (35%) Gaps:47/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1672 PFIRMQLWLS-DANNVE---RLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGP 1732
            |.:..:::.| .::|:|   :|:..:...|...|..|.:..|..:...|..|........|| ..
  Fly    23 PTVSGEIYSSHQSHNLESEDKLEDREESGRNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSS-NF 86

  Fly  1733 GSVGSGVGG----APPS--------------KKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLA 1779
            |..|:|.||    ||.|              ::.|..||..|..||...|....||:....|.||
  Fly    87 GPTGAGCGGADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELA 151

  Fly  1780 NELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSRESTSATPFDPVQFRILLQQRLLELHK 1844
            .::.|:...:..||.|.|.:.::        .:..:.||......|      :::.......:||
  Fly   152 TKVHLSEARVQVWFQNRRAKFRR--------NERSVGSRTLLDTAP------QLVPAPISNNMHK 202

  Fly  1845 ERMGMSGAPIPYPPYFAAAAILG----RSLAGIPGAAAAAGAAAAAAAVGASG 1893
            ........|.|.||..|.|...|    ||...........|::      ||||
  Fly   203 YANMPHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGSS------GASG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 4/21 (19%)
Homeobox 1749..1801 CDD:278475 17/51 (33%)
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.