DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and lms

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:462 Identity:94/462 - (20%)
Similarity:131/462 - (28%) Gaps:226/462 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly  1704 RSTGP--------NQQDNSS--DTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKE 1758
            |::.|        |..|..|  |.:|:|              |:|:|. ...|:.|..||..|.:
  Fly    50 RASSPATSSCLDDNMDDGKSDIDLASDD--------------GNGLGD-DRKKRPRTAFSAAQIK 99

  Fly  1759 ALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQ--------------------- 1802
            ||...|....|.:|.....||.:|.|....|..||.|.|.:.|:                     
  Fly   100 ALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRKYTSDVETLASHYYAQLGIGG 164

  Fly  1803 ---------------QVPHGPA--------GQDNPIPSRESTSATPFDPVQFRILLQQRLLELHK 1844
                           |.|.||.        |..:..|...:|:||                    
  Fly   165 LARPMVVGDRLWLFSQTPTGPTPIQSIMLNGSGSAAPMASATTAT-------------------- 209

  Fly  1845 ERMGMSGAPI-PY------PPYFAAAAILGRSLAGIPGAAAAAGAAAAAAAVGASGGDELQALNQ 1902
                  |:|: ||      ||              :||.:....|..|..|.|       |.||.
  Fly   210 ------GSPMRPYATSGGMPP--------------LPGPSVMESARNAILARG-------QPLNF 247

  Fly  1903 AFKEQMSGLDLSMPTLKRERSDDYQDDLELEGGGHNLSDNESLEGQEPEDKTTDYEKVLHKSALA 1967
            |..     ..::.|                ..||                              .
  Fly   248 ALP-----FGVAKP----------------PAGG------------------------------V 261

  Fly  1968 AAAAYMSNAVRSSRRKPAAPQWVNPAGAV-TNPSAV---VAAVAAAAAAAADN-----ERII--- 2020
            .||:|:      .|.||.|..:|:.|.:: ||.|.:   .|.:...|.:.|.|     ||:.   
  Fly   262 PAASYI------PRCKPYATSYVDYAASLPTNESYLQMKYATLPPEAESGASNGLAELERVFGDA 320

  Fly  2021 NGVCVMQ--------ASEYGRDDTD----SNKPTDGG---NDSDHEHAQLEIDQRFMEPEVHIKQ 2070
            |...:.|        |:.||.|..:    |.:||...   :|.|.||.                 
  Fly   321 NANFLQQRSTPVAGTATAYGHDGLNQAQRSRRPTQSESECSDIDCEHL----------------- 368

  Fly  2071 EEDDDEE 2077
              |:|||
  Fly   369 --DEDEE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 18/51 (35%)
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 18/70 (26%)
Homeobox 89..142 CDD:278475 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.