DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ct and ISL1

DIOPT Version :9

Sequence 1:	NP_524764.1	Gene:	ct / 44540	FlyBaseID:	FBgn0004198	Length:	2175	Species:	Drosophila melanogaster
Sequence 2:	NP_002193.2	Gene:	ISL1 / 3670	HGNCID:	6132	Length:	349	Species:	Homo sapiens

Alignment Length:	75	Identity:	25/75 - (33%)
Similarity:	35/75 - (46%)	Gaps:	12/75 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly  1744 PSKKQRV--LFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMR------- 1799
            |.|..||  :.:|:|...||..:|.:|.|:....|.|....||:.|.|..||.|.|.:
Human   178 PEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIM 242

  Fly  1800 ---LKQQVPH 1806
               |:||.|:
Human   243 MKQLQQQQPN 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ct	NP_524764.1	CUT	886..955	CDD:280527
		CUT	1335..1411	CDD:280527
		CUT	1616..1690	CDD:280527
		Homeobox	1749..1801	CDD:278475	19/63 (30%)
ISL1	NP_002193.2	LIM1_Isl	17..71	CDD:188752
		LIM domain	20..73
		LIM2_Isl	79..133	CDD:188760
		LIM domain	82..136
		HOX	181..237	CDD:197696	19/55 (35%)
		Homeodomain	184..243		18/58 (31%)
		LIM-binding domain (LID). /evidence=ECO:0000250	262..291
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	312..349
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910