DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and so

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster


Alignment Length:496 Identity:101/496 - (20%)
Similarity:165/496 - (33%) Gaps:149/496 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 QHQQQDTEDLEENKDAGEASLNVSNNHNTTDSNNSCSRKNNNGGNESEQHVASSAEDDDCANNNT 387
            ||...|..||.....|...:...:..::.|..:.|.:..|||                   |||:
  Fly     3 QHPATDFYDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNN-------------------NNNS 48

  Fly   388 NTSNNNNTSNTATSNTNNN-----NNNNSSSGNSEKRKKKNNNNNNGQPAVLLAAKDKEIKALLD 447
            :||||||::....::....     :.|:||:|...........:...:.........:::..:.:
  Fly    49 STSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGGGGVVSGGGSGGRENLPSFGFTQEQVACVCE 113

  Fly   448 ELQRLRAQEQTHLVQIQRLEEHLEVKRQHIIRLEARLDKQQINEALAEATALSAAASTNN----- 507
            .||:..        .|:||...|....|        .||.|:||::.:|.|:.|......     
  Fly   114 VLQQAG--------NIERLGRFLWSLPQ--------CDKLQLNESVLKAKAVVAFHRGQYKELYR 162

  Fly   508 --NNNSQSSDNNKKLN--------TAAE----RPMDASSNADLPESTKAPVPAEDDEE------D 552
              .::..|:.|:.||.        ..||    ||:.|.....:......|....|.||      :
  Fly   163 LLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKE 227

  Fly   553 EDQAMLVD--SEEAEDKPEDSHHDDDEDEDEDREAVNATTTD-SNELKIKKEQHSPLDLNVLSPN 614
            :.:::|.|  |......|.:..        :..||...|||. ||..|.::::..          
  Fly   228 KSRSVLRDWYSHNPYPSPREKR--------DLAEATGLTTTQVSNWFKNRRQRDR---------- 274

  Fly   615 SAIAAAAAAAAAAACANDPNKFQALLIERTKALAAEALKNGASDA----LSEDAHHQQQQHHQQQ 675
                                             |||. |:|::|.    .|.|:..:......|.
  Fly   275 ---------------------------------AAEH-KDGSTDKQHLDSSSDSEMEGSMLPSQS 305

  Fly   676 HQHQQQHHQQQHLHQQHHHHLQQQPNSGSNSNPASNDHHHGHHLHGHGLLHPSS----AHHLHHQ 736
            .|||||..||||           .|.:.|.:|         :.||...|.|.::    .||.|..
  Fly   306 AQHQQQQQQQQH-----------SPGNSSGNN---------NGLHQQQLQHVAAEQGLQHHPHQP 350

  Fly   737 TTESN-SNSSTPTAAGNNNGSNNSSSNTNANSTAQLAASLA 776
            ...|| :|.:...::|...|...|::.........|.|::|
  Fly   351 HPASNIANVAATKSSGGGGGGGVSAAAAAQMQMPPLTAAVA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
soNP_476733.1 SIX1_SD 103..212 CDD:293483 24/124 (19%)
homeodomain 223..274 CDD:238039 12/58 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.