DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and ap

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:163 Identity:34/163 - (20%)
Similarity:63/163 - (38%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1696 RREASKRRRSTGPNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEAL 1760
            |::...|:|    ..:|..:.|::.|.|..|...    ..||.:..:..:|:.|..|...|...:
  Fly   326 RQKGRPRKR----KPKDIEAFTANIDLNTEYVDF----GRGSHLSSSSRTKRMRTSFKHHQLRTM 382

  Fly  1761 RLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSRESTSATP 1825
            :..||::..|:...::.|:.:.||..|.:..||.|.|.:.::.:    ..||......:...|..
  Fly   383 KSYFAINHNPDAKDLKQLSQKTGLPKRVLQVWFQNARAKWRRMM----MKQDGSGLLEKGEGALD 443

  Fly  1826 FDPVQFRILLQQRLLELHKERMGMSGAPIPYPP 1858
            .|.:           .:|.....:.|.|...||
  Fly   444 LDSI-----------SVHSPTSFILGGPNSTPP 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 14/51 (27%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeobox 371..424 CDD:395001 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.