Sequence 1: | NP_524764.1 | Gene: | ct / 44540 | FlyBaseID: | FBgn0004198 | Length: | 2175 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_722629.1 | Gene: | al / 33208 | FlyBaseID: | FBgn0000061 | Length: | 408 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 63/206 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 1729 SPGPGSVGSGV---------GGAP---------------------------PSKKQ---RVLFSE 1754
Fly 1755 EQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQD-NP-IPS 1817
Fly 1818 RESTSAT---------PFDPVQFRILLQQRLLELHKERMG------MSGAPIPYPPYF-----AA 1862
Fly 1863 AAILGRSLAGI 1873 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ct | NP_524764.1 | CUT | 886..955 | CDD:280527 | |
CUT | 1335..1411 | CDD:280527 | |||
CUT | 1616..1690 | CDD:280527 | |||
Homeobox | 1749..1801 | CDD:278475 | 21/51 (41%) | ||
al | NP_722629.1 | Homeobox | 89..141 | CDD:278475 | 21/51 (41%) |
OAR | 374..391 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |