DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and al

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:206 Identity:53/206 - (25%)
Similarity:77/206 - (37%) Gaps:63/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1729 SPGPGSVGSGV---------GGAP---------------------------PSKKQ---RVLFSE 1754
            :||..:..:|.         ||||                           |.:||   |..|:.
  Fly    30 APGSSAASAGAALTVSMSVSGGAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTS 94

  Fly  1755 EQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQD-NP-IPS 1817
            .|.|.|..||:...||:|.|.|.||.::||....|..||.|.|.:.::|...||.... || :|.
  Fly    95 FQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPG 159

  Fly  1818 RESTSAT---------PFDPVQFRILLQQRLLELHKERMG------MSGAPIPYPPYF-----AA 1862
            ..:|..|         ||..:.|:  |::.....|...:.      :|.||:....||     |.
  Fly   160 GAATMQTVVGAALPPNPFTHLGFQ--LRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAP 222

  Fly  1863 AAILGRSLAGI 1873
            ..:|...:||:
  Fly   223 PHMLPHGMAGM 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475 21/51 (41%)
alNP_722629.1 Homeobox 89..141 CDD:278475 21/51 (41%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.