DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and OdsH

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:371 Identity:86/371 - (23%)
Similarity:137/371 - (36%) Gaps:92/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DEQQQQLQQTAS--GGILESDSDKLLNSSIVAAAITLQQQNGSNLLANTNTPSPSPPLLSAEQQQ 160
            |:..|||||.|:  |.:........|.....|||:.:|....|::| |.:..:|:|.:       
  Fly     2 DQLIQQLQQAAAARGQVQHPHGSSALQLYAAAAAVNMQVSGWSSVL-NLSMDAPNPEI------- 58

  Fly   161 QLQSSLQQSGGVGGACLNPKLFFNHAQQMMMMEAAAAAAAAALQQQQQQQSPLH-----SPANEV 220
             ..:|:..|..|          :...|..::.:|..||||.|:|||||||..|:     .|.:|.
  Fly    59 -SPNSVTNSSSV----------YMIRQMALIQQARVAAAAVAMQQQQQQQRDLNRELGMDPHSEQ 112

  Fly   221 AIPTEQPAATVATGAAAAAAAAATPI----ATGNVKSGSTTSNA----NHTNSNN---------- 267
            .|..:..:.|....|.::......|:    |..|:.....|.::    ..||.|:          
  Fly   113 RIKLDSVSPTHNIHAGSSRGIKQDPLSDEGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVF 177

  Fly   268 --SHQDE--------EELDDEE---------------EDEEEDEDEDDEEENASMQSNADD---- 303
              ||..:        .:||..|               :.|...:.......||..||.:.|    
  Fly   178 QGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGRPAHNAHPQSCSGDPIPL 242

  Fly   304 MELDAQ---QETRTEPSATTQQQHQQQDTEDLEENKDAGEASLNVSNNHNTTDSNNSCSRKNNNG 365
            .||.|:   |.::....|..:|..:.|| :.||.:....||....::..|..|.||..   :::|
  Fly   243 SELRARELAQRSKRMKKAIDRQAKKLQD-KGLEVDYARLEAEYLAAHQENGVDENNWL---DDDG 303

  Fly   366 ---------GNESEQHVASSAEDDDCANNNTNTSNNNNTSNTATSN 402
                     |.|.|.....|.:...|   ::.|....:||:...||
  Fly   304 YDDLHIDVVGVEPEYVTGDSLDHSFC---SSRTYQTKSTSSELDSN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 8/51 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.