DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and exd

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_001259592.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster


Alignment Length:531 Identity:96/531 - (18%)
Similarity:177/531 - (33%) Gaps:186/531 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1420 PEKLMRTGSYSGSPQMPQGLASKMQAASLPMQKMMSELKLQEPAQAQHLMQQMQAAAMSAAMQQQ 1484
            |.:::   :::|....|||.....|...   |...||.::::......::||:    ||.:.|..
  Fly     4 PNRML---AHTGGMMAPQGYGLSGQDDG---QNAGSENEVRKQKDIGEILQQI----MSISEQSL 58

  Fly  1485 QVAQAQQQAQQAQQAQQ-------HLQQQAQQHLQQQQHLAQQQHPHQQHHQAAAAAAALHHQSM 1542
            ..|||::......:.:.       .::::....::..|   :::.|..|         .:...:|
  Fly    59 DEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQ---EEEPPDPQ---------LMRLDNM 111

  Fly  1543 LLTSPGLPPQH--AISLPPSAGGAQPGGPGGNQGSSNP-SNSEKKPMLMPVHGTNAMRSLHQHMS 1604
            |:......|:.  ..:...||..|..||.....|:.|. .:|:.:..|..:.     :..||.:.
  Fly   112 LIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAIEHSDYRAKLAQIR-----QIYHQELE 171

  Fly  1605 P--------TVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKP 1661
            .        |.:.|..|.:...|..||.|..|.::  .|..|.|..                   
  Fly   172 KYEQACNEFTTHVMNLLREQSRTRPITPKEIERMV--QIIHKKFSS------------------- 215

  Fly  1662 WHMLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFY 1726
                        |:|||   ..:..|.:.:|::...:|.::||        |.|..:|...|:::
  Fly   216 ------------IQMQL---KQSTCEAVMILRSRFLDARRKRR--------NFSKQASEILNEYF 257

  Fly  1727 TSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITN 1791
            .|                                   ...:|||:....|.||.:.|:....::|
  Fly   258 YS-----------------------------------HLSNPYPSEEAKEELARKCGITVSQVSN 287

  Fly  1792 WFHNHRMRLKQQVPHGPAGQD-NPIPSRESTSATPFDPVQFRILLQQRLLELHKERMGMSGAP-- 1853
            ||.|.|:|.|:.:  |.|.:: |...::::..|:|:                     .|:|.|  
  Fly   288 WFGNKRIRYKKNI--GKAQEEANLYAAKKAAGASPY---------------------SMAGPPSG 329

  Fly  1854 ------IPYPPYFAAAAILGRSLAGIPGAAAAAGAAAAAAAVGASGGDELQALNQAFKEQMSGLD 1912
                  .|.||         :...|.|              :|:.|.|:    .|.:...|.|.|
  Fly   330 TTTPMMSPAPP---------QDSMGYP--------------MGSGGYDQ----QQPYDNSMGGYD 367

  Fly  1913 LSMPTLKRERS 1923
               |.|.::.|
  Fly   368 ---PNLHQDLS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 13/73 (18%)
Homeobox 1749..1801 CDD:278475 13/51 (25%)
exdNP_001259592.1 PBC 41..237 CDD:397732 42/252 (17%)
homeodomain 239..299 CDD:238039 21/102 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.