DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and HOXD3

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:541 Identity:112/541 - (20%)
Similarity:163/541 - (30%) Gaps:199/541 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1491 QQAQQAQQAQQHLQQQAQQH----------LQQQQHLAQQQHPHQQHHQAAAAA--------AAL 1537
            :|.|||.:..:...|:|..:          ..:.........|||.:...|||:        :|.
Human     4 EQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLDTDYPGSAC 68

  Fly  1538 HHQSMLLTSPGLPPQH------AISLPPSAGGAQPGG-----PGGNQGSSNPSNSEKKPMLMPVH 1591
            ..||   ::|...|.|      ...:.|..|.:|.||     ||.|.....|......|.|.|..
Human    69 SIQS---SAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPPPPPPTLPPSS 130

  Fly  1592 GTN---AMRSLHQHMSPTVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVS 1653
            .||   .:.:......|.....:|                     .|.::||             
Human   131 PTNPGGGVPAKKPKGGPNASSSSA---------------------TISKQIF------------- 161

  Fly  1654 ELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTS 1718
                   ||                              ..|.|:.||         |.||..|:
Human   162 -------PW------------------------------MKESRQNSK---------QKNSCATA 180

  Fly  1719 SNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPY---PNVGTIEFLAN 1780
            .....|  .|.|||.           ||:.|..::..|...|...|..:.|   |.  .:| :||
Human   181 GESCED--KSPPGPA-----------SKRVRTAYTSAQLVELEKEFHFNRYLCRPR--RVE-MAN 229

  Fly  1781 ELGLATRTITNWFHNHRMRLKQQ-----VPHGPA--------------------GQDNPIPSRES 1820
            .|.|..|.|..||.|.||:.|:.     :.|.||                    ||..|:|....
Human   230 LLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPASQSPERSPPLGGAAGHVAYSGQLPPVPGLAY 294

  Fly  1821 TSATPFDPVQFRILLQQRLLELHKERMGMSG-----AP----IPYPPYFAAAAILGRSLAGIPGA 1876
            .:.:|  |.            ..|.:..|.|     ||    :|....:||.......:|...|.
Human   295 DAPSP--PA------------FAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGG 345

  Fly  1877 AAAAGAAAAAAAVGASGGDELQALNQAFKEQMSGLDLSMPTLKRERSDDYQDDLELEGGGH---- 1937
            .|:|....:...|   ||:.::::..|.....:...||.|:   ..|.||....::.|..|    
Human   346 FASANLQGSPVYV---GGNFVESMAPASGPVFNLGHLSHPS---SASVDYSCAAQIPGNHHHGPC 404

  Fly  1938 -------NLSDNESLEGQEPE 1951
                   :||.:.|.:|:.||
Human   405 DPHPTYTDLSAHHSSQGRLPE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 5/73 (7%)
Homeobox 1749..1801 CDD:278475 18/54 (33%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 41/224 (18%)
Antp-type hexapeptide 160..165 4/54 (7%)
Homeobox 198..250 CDD:306543 18/54 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280 3/26 (12%)
DUF4074 369..430 CDD:315871 15/60 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.