DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and Onecut2

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_017456611.2 Gene:Onecut2 / 307376 RGDID:1564677 Length:505 Species:Rattus norvegicus


Alignment Length:628 Identity:144/628 - (22%)
Similarity:217/628 - (34%) Gaps:211/628 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1231 GGGTP-------APPAPPSGPGTGAGA-----PPTAAPPTGGASSNSAAPSPLSNSILPPALSS- 1282
            |||.|       |.|:|.......||:     ||||....|.|::.:||   .|.|.:..:::| 
  Rat    51 GGGGPGHEQELLASPSPHHAGRGAAGSLRGPPPPTAHQELGTAAAAAAA---ASRSAMVTSMASI 112

  Fly  1283 -QGEEFAATAS-PLQRMASITNSLITQPP-----VTPHHSTPQRPTKAVLPPITQQQFDMFNNLN 1340
             .|.::....| ||....|:  |..:.||     .|....||.:|    ||||:           
  Rat   113 LDGSDYRPELSIPLHHAMSM--SCDSSPPGMGMSNTYTTLTPLQP----LPPIS----------- 160

  Fly  1341 TEDIVRRVKEALSQYSISQRLFGESVLGLSQGSVSDLLARPKPWHMLTQKGREPFIRMKMFLEDE 1405
                                            :|||....|.|.|                    
  Rat   161 --------------------------------TVSDKFHHPHPHH-------------------- 173

  Fly  1406 NAVHKLVASQYKIAPEKLMRTGSYSGSPQM---PQGLASKMQAASLPMQKMMSELKLQEPAQAQH 1467
               |......:....::|  :|:.|||..:   .:||.|        |..:.|..| :.|:.:|.
  Rat   174 ---HPHHHHHHHHHHQRL--SGNVSGSFTLMRDERGLPS--------MNNLYSPYK-EMPSMSQS 224

  Fly  1468 LMQQMQAAAMSAAMQQQQVAQAQQQAQQAQQAQQHLQQQAQQHLQQQQHLAQQQHPH---QQHHQ 1529
            | ..:.|..:...:                               ...|.|||..|:   ..|.:
  Rat   225 L-SPLAATPLGNGL-------------------------------GGLHNAQQSLPNYGPPGHDK 257

  Fly  1530 AAAAAAALHHQSMLLTSPGLPPQH---AISLPPSAGGAQPGG---PGGNQGSSNPSNSEKKPMLM 1588
            ..:.....||.:||...    .||   .:..||:|..:...|   ||..|...        |:|.
  Rat   258 MLSPNFDAHHTAMLTRG----EQHLSRGLGTPPAAMMSHLNGLHHPGHTQSHG--------PVLA 310

  Fly  1589 PVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVS 1653
            |........|     |.:....:...::::|.::..:|...|...:|.|.||.:.||..|||::|
  Rat   311 PSRERPPSSS-----SGSQVATSGQLEEINTKEVAQRITAELKRYSIPQAIFAQRVLCRSQGTLS 370

  Fly  1654 ELLSKPKPWHMLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTS 1718
            :||..||||..|. .|||.|.||..||.:. ..:|:..|    |.|:.:|:...||:..|:|   
  Rat   371 DLLRNPKPWSKLK-SGRETFRRMWKWLQEP-EFQRMSAL----RLAACKRKEQEPNKDRNNS--- 426

  Fly  1719 SNDTNDFYTSSPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELG 1783
                                      .||.|::|::.|:..|...|..:..|:......::.:||
  Rat   427 --------------------------QKKSRLVFTDLQRRTLFAIFKENKRPSKEMQITISQQLG 465

  Fly  1784 LATRTITNWFHNHRMRL--KQQVPHGPAGQDNPIPSRESTSAT 1824
            |...|::|:|.|.|.|.  |.|...|..|.       .|||.|
  Rat   466 LELTTVSNFFMNARRRSLEKWQDDLGTGGS-------SSTSGT 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527 7/75 (9%)
CUT 1616..1690 CDD:280527 29/73 (40%)
Homeobox 1749..1801 CDD:278475 15/53 (28%)
Onecut2XP_017456611.2 CUT 332..404 CDD:396794 28/73 (38%)
HOX 427..482 CDD:197696 16/54 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.