DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and LHX6

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:XP_011516823.1 Gene:LHX6 / 26468 HGNCID:21735 Length:407 Species:Homo sapiens


Alignment Length:414 Identity:78/414 - (18%)
Similarity:129/414 - (31%) Gaps:166/414 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1526 QHHQAAAAAAALHHQSMLLTSPGLPPQHAISLPPSAG---------GAQP------------GGP 1569
            :|..||.|..    :...|.:.|.|....:...|.:|         |..|            |..
Human     4 KHENAAPALP----EGCRLPAEGGPATDQVMAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGAL 64

  Fly  1570 GGNQGSSNPSNSEKKPMLMPVHGTNAMRSLHQHMSPTVYEMAALTQDLDTHDITTKIKEALLANN 1634
            ..::|.::|.......:..|....:::.|..::                            :.::
Human    65 DKDEGQASPCTPSTPSVCSPPSAASSVPSAGKN----------------------------ICSS 101

  Fly  1635 IGQKIFGEAVLGLSQGSVSELLSKPKPWHM-----------------LSIKGREPFIRM------ 1676
            .|.:|....:|     .|:.|:     ||:                 ..||.:|.|.:|      
Human   102 CGLEILDRYLL-----KVNNLI-----WHVRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRF 156

  Fly  1677 ---------QLWLSDANNVERLQLLKNERREA----------SKRRRSTG--------------- 1707
                     |::.||        .::..|..|          .||:.|||               
Human   157 GTKCARCGRQIYASD--------WVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIH 213

  Fly  1708 -PNQQDNSSDTSSNDTNDFYTSSPGPGSVGSGV---GGAP--------PSKKQRVLFSEEQKEAL 1760
             ....:|....:.|               |:|:   |..|        |:|:.|..|:.||.:.:
Human   214 YDTMIENLKRAAEN---------------GNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVM 263

  Fly  1761 RLAFALDPYPNVGTIEFLANELGLATRTITNWFHNHRMRLKQQVPHGPAGQDNPIPSR------E 1819
            :..||.|..|:..|::.||:..||:.|.|..||.|.|.|.|:..|..|.......|||      :
Human   264 QAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSD 328

  Fly  1820 STSATPFDPVQFRILLQQRLLELH 1843
            ....|||...:     :.|::.||
Human   329 DIHYTPFSSPE-----RARMVTLH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 15/105 (14%)
Homeobox 1749..1801 CDD:278475 20/51 (39%)
LHX6XP_011516823.1 LIM1_Lhx6 99..152 CDD:188766 12/62 (19%)
LIM2_Lhx6 160..214 CDD:188768 10/61 (16%)
Homeobox 252..304 CDD:278475 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.