DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and ceh-48

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_501046.1 Gene:ceh-48 / 182756 WormBaseID:WBGene00015934 Length:459 Species:Caenorhabditis elegans


Alignment Length:428 Identity:95/428 - (22%)
Similarity:154/428 - (35%) Gaps:112/428 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1199 SSLEHSAGSSSCSKDG---ERDDAYPSSLH----------------------GRKSEGGG----- 1233
            |.:.|:..|.....||   :.||..|.|.|                      ||.|....     
 Worm    19 SPIHHAILSMDDEVDGNCDDVDDISPESHHDNHFIDFTDDLVVQTERNLSKKGRTSNRNARQGYD 83

  Fly  1234 -----TPAPPAPPSGPGTGAGAP---PTAAP----PTGGASS-----------------NSAAPS 1269
                 |...|.||....|.....   |:.:|    ||...||                 :|::||
 Worm    84 NYATLTNLQPLPPISTVTSKSTKVQRPSPSPNFYFPTSSNSSYDMKYEEEEDDCEGITHSSSSPS 148

  Fly  1270 PLSN---SILPPALSSQGEEFAATASPLQRMASITNS---LITQPPVTPHHSTPQRP----TKAV 1324
            ..||   .:..|..:|..:.|..|.......::|.||   .|.:  :....||.:.|    ..|:
 Worm   149 DFSNHGTDLNHPFSASSFDSFDVTTVSTTATSTIMNSTDKFIAR--IQEADSTTKSPKGTSPAAL 211

  Fly  1325 LPPITQQQFDMFNNLNTEDIVRRVKEALSQYSISQRLFGESVLGLSQGSVSDLLARPKPWHMLTQ 1389
            :....::.||....|||:::..::...|.:|||.|.:|.|.||..|||::||||..||||..| :
 Worm   212 MHGHCEEDFDDGEELNTKELALQIAAELKRYSIPQAIFAERVLCRSQGTLSDLLRNPKPWSKL-K 275

  Fly  1390 KGREPFIRMKMFLEDENAVHKLVASQYKIAPEKLMRTGSYSGSPQMPQGLASKMQAASLPMQKMM 1454
            .|||.|.||..:||:.....   .|..::|..|.....:...||||                   
 Worm   276 SGRETFRRMAKWLEEPEFQR---MSALRLAACKRKEEHTTPNSPQM------------------- 318

  Fly  1455 SELKLQEPAQAQHLMQQMQAAAMSAAMQQQQVAQAQQQAQQAQQAQ-------------QHLQQQ 1506
                 ..|.:.:.:...:|...:.|..::.:....:.|...:||..             :.....
 Worm   319 -----VVPKKTRLVFSDIQRRTLQAIFRETKRPSREMQITISQQLNLDPTTVANFFMNARRRGHD 378

  Fly  1507 AQQHLQQQQHLAQQQHPHQQHHQAAAAAAALHHQSMLL 1544
            .:|...:.:..:::...|.:|..::::|::....||.|
 Worm   379 LKQETSESEERSEEPSIHFEHSASSSSASSSSSSSMQL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527 32/75 (43%)
CUT 1616..1690 CDD:280527
Homeobox 1749..1801 CDD:278475
ceh-48NP_501046.1 CUT 222..296 CDD:280527 32/77 (42%)
HOX 321..375 CDD:197696 6/53 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.