DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ct and dsc-1

DIOPT Version :9

Sequence 1:NP_524764.1 Gene:ct / 44540 FlyBaseID:FBgn0004198 Length:2175 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:270 Identity:65/270 - (24%)
Similarity:91/270 - (33%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1549 LPPQHAI------SLPPSAGGAQPGGPGGNQG-------SSNPSNSEKKPMLMPVHGTNAMRSLH 1600
            ||...|:      |:||...|||...|..|.|       |...|....:|.....|  |...:||
 Worm    20 LPKSEALSVTTDFSVPPVQQGAQQFHPPRNLGPQLARRWSCGDSQHADEPPASYYH--NLGVALH 82

  Fly  1601 QH--MSPTVYEMAALTQDLDTHDITTKIKEALLANNIGQKIFGEAVLGLSQGSVSELLSKPKPWH 1663
            .|  ||...|        |...|..|.:.....|:..||         |.|.|..:.:....| |
 Worm    83 NHFQMSNQHY--------LSDFDCPTTVSPISSAHETGQ---------LPQLSPYDHIGNQDP-H 129

  Fly  1664 MLSIKGREPFIRMQLWLSDANNVERLQLLKNERREASKRRRSTGPNQQDNSSDTSSNDTNDFYTS 1728
            |.|     |.......:.|.:..|      |..|..|      .||       ..::..|....|
 Worm   130 MFS-----PHAYGNSMIPDNSYFE------NASRSIS------APN-------VGNSTLNPSLMS 170

  Fly  1729 SPGPGSVGSGVGGAPPSKKQRVLFSEEQKEALRLAFALDPYPNVGTIEFLANELGLATRTITNWF 1793
            |....|.|.       .::.|..|:|.|...|..:|....||:....:::|:.|.:....||.||
 Worm   171 SDNAQSCGG-------RRRFRTNFTELQSTFLEDSFKESHYPDHKAKKYMADFLKIPEDRITVWF 228

  Fly  1794 HNHRMRLKQQ 1803
            .|.|.:.:::
 Worm   229 QNRRAKWRRK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ctNP_524764.1 CUT 886..955 CDD:280527
CUT 1335..1411 CDD:280527
CUT 1616..1690 CDD:280527 16/73 (22%)
Homeobox 1749..1801 CDD:278475 16/51 (31%)
dsc-1NP_510497.1 Homeobox 184..236 CDD:278475 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.